beta 1 Sodium Potassium ATPase (ATP1B1) (NM_001677) Human Tagged ORF Clone

CAT#: RG200500

  • TrueORF®

ATP1B1 (tGFP-tagged) - Human ATPase, Na+/K+ transporting, beta 1 polypeptide (ATP1B1)

ORF Plasmid: DDK tGFP

Lentiviral Particles: DDK DDK w/ Puro mGFP mGFP w/ Puro

AAV Particle: DDK


  "NM_001677" in other vectors (6)

Reconstitution Protocol

USD 500.00

In Stock*

Size
    • 10 ug

Product Images

Frequently bought together (5)
pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
    • 10 ug

USD 750.00


Mouse monoclonal turboGFP antibody, clone OTI2H8
    • 100 ul

USD 412.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00


Rabbit anti-ATP1B1 Polyclonal Antibody
    • 100 ul

USD 365.00

Other products for "beta 1 Sodium Potassium ATPase"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag TurboGFP
Symbol beta 1 Sodium Potassium ATPase
Synonyms ATP1B
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RG200500 representing NM_001677
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCCCGCGGGAAAGCCAAGGAGGAGGGCAGCTGGAAGAAATTCATCTGGAACTCAGAGAAGAAGGAGT
TTCTGGGCAGGACCGGTGGCAGTTGGTTTAAGATCCTTCTATTCTACGTAATATTTTATGGCTGCCTGGC
TGGCATCTTCATCGGAACCATCCAAGTGATGCTGCTCACCATCAGTGAATTTAAGCCCACATATCAGGAC
CGAGTGGCCCCGCCAGGATTAACACAGATTCCTCAGATCCAGAAGACTGAAATTTCCTTTCGTCCTAATG
ATCCCAAGAGCTATGAGGCATATGTACTGAACATAGTTAGGTTCCTGGAAAAGTACAAAGATTCAGCCCA
GAGGGATGACATGATTTTTGAAGATTGTGGCGATGTGCCCAGTGAACCGAAAGAACGAGGAGACTTTAAT
CATGAACGAGGAGAGCGAAAGGTCTGCAGATTCAAGCTTGAATGGCTGGGAAATTGCTCTGGATTAAATG
ATGAAACTTATGGCTACAAAGAGGGCAAACCGTGCATTATTATAAAGCTCAACCGAGTTCTAGGCTTCAA
ACCTAAGCCTCCCAAGAATGAGTCCTTGGAGACTTACCCAGTGATGAAGTATAACCCAAATGTCCTTCCC
GTTCAGTGCACTGGCAAGCGAGATGAAGATAAGGATAAAGTTGGAAATGTGGAGTATTTTGGACTGGGCA
ACTCCCCTGGTTTTCCTCTGCAGTATTATCCGTACTATGGCAAACTCCTGCAGCCCAAATACCTGCAGCC
CCTGCTGGCCGTACAGTTCACCAATCTTACCATGGACACTGAAATTCGCATAGAGTGTAAGGCGTACGGT
GAGAACATTGGGTACAGTGAGAAAGACCGTTTTCAGGGACGTTTTGATGTAAAAATTGAAGTTAAGAGC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>RG200500 representing NM_001677
Red=Cloning site Green=Tags(s)

MARGKAKEEGSWKKFIWNSEKKEFLGRTGGSWFKILLFYVIFYGCLAGIFIGTIQVMLLTISEFKPTYQD
RVAPPGLTQIPQIQKTEISFRPNDPKSYEAYVLNIVRFLEKYKDSAQRDDMIFEDCGDVPSEPKERGDFN
HERGERKVCRFKLEWLGNCSGLNDETYGYKEGKPCIIIKLNRVLGFKPKPPKNESLETYPVMKYNPNVLP
VQCTGKRDEDKDKVGNVEYFGLGNSPGFPLQYYPYYGKLLQPKYLQPLLAVQFTNLTMDTEIRIECKAYG
ENIGYSEKDRFQGRFDVKIEVKS

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_001677
ORF Size 909 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_001677.4
RefSeq Size 2212 bp
RefSeq ORF 912 bp
Locus ID 481
UniProt ID P05026
Cytogenetics 1q24.2
Domains Na_K-ATPase
Protein Families Transmembrane
Protein Pathways Cardiac muscle contraction
Gene Summary The protein encoded by this gene belongs to the family of Na+/K+ and H+/K+ ATPases beta chain proteins, and to the subfamily of Na+/K+ -ATPases. Na+/K+ -ATPase is an integral membrane protein responsible for establishing and maintaining the electrochemical gradients of Na and K ions across the plasma membrane. These gradients are essential for osmoregulation, for sodium-coupled transport of a variety of organic and inorganic molecules, and for electrical excitability of nerve and muscle. This enzyme is composed of two subunits, a large catalytic subunit (alpha) and a smaller glycoprotein subunit (beta). The beta subunit regulates, through assembly of alpha/beta heterodimers, the number of sodium pumps transported to the plasma membrane. The glycoprotein subunit of Na+/K+ -ATPase is encoded by multiple genes. This gene encodes a beta 1 subunit. Alternatively spliced transcript variants encoding different isoforms have been described, but their biological validity is not known. [provided by RefSeq, Mar 2010]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.