PLCG 2 (PLCG2) (NM_002661) Human Tagged ORF Clone

CAT#: RG200442

Reviews ()
Write a review
  • TrueORF®

PLCG2 (GFP-tagged) - Human phospholipase C, gamma 2 (phosphatidylinositol-specific) (PLCG2)



  "NM_002661" in other vectors (7)

USD 1,250.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name PLCG 2 (PLCG2) (NM_002661) Human Tagged ORF Clone
Type Human Tagged ORF Clone
Tag TurboGFP
Symbol PLCG2
Synonyms APLAID; FCAS3; PLC-gamma-2; PLC-IV
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Cell Selection Neomycin
Sequence Data
>RG200442 representing NM_002661
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCCACCACGGTCAATGTAGATTCCCTTGCGGAATATGAGAAGAGCCAGATCAAGAGAGCCCTGGAGC
TGGGGACGGTGATGACTGTGTTCAGCTTCCGCAAGTCCACCCCCGAGCGGAGAACCGTCCAGGTGATCAT
GGAGACGCGGCAGGTGGCCTGGAGCAAGACCGCCGACAAGATCGAGGGCTTCTTGGATATCATGGAAATA
AAAGAAATCCGCCCAGGGAAGAACTCCAAAGATTTCGAGCGAGCAAAAGCAGTTCGCCAGAAAGAAGACT
GCTGCTTCACCATCCTATATGGCACTCAGTTCGTCCTCAGCACGCTCAGCTTGGCAGCTGACTCTAAAGA
GGATGCAGTTAACTGGCTCTCTGGCTTGAAAATCTTACACCAGGAAGCGATGAATGCGTCCACGCCCACC
ATTATCGAGAGTTGGCTGAGAAAGCAGATATATTCTGTGGATCAAACCAGAAGAAACAGCATCAGTCTCC
GAGAGTTGAAGACCATCTTGCCCCTGATCAACTTTAAAGTGAGCAGTGCCAAGTTCCTTAAAGATAAGTT
TGTGGAAATAGGAGCACACAAAGATGAGCTCAGCTTTGAACAGTTCCATCTCTTCTATAAAAAACTTATG
TTTGAACAGCAAAAATCGATTCTCGATGAATTCAAAAAGGATTCGTCCGTGTTCATCCTGGGGAACACTG
ACAGGCCGGATGCCTCTGCTGTTTACCTGCGTGACTTCCAGAGGTTTCTCATACATGAACAGCAGGAGCA
TTGGGCTCAGGATCTGAACAAAGTCCGTGAGCGGATGACAAAGTTCATTGATGACACCATGCGTGAAACT
GCTGAGCCTTTCTTGTTTGTGGATGAGTTCCTCACGTACCTGTTTTCACGAGAAAACAGCATCTGGGATG
AGAAGTATGACGCGGTGGACATGCAGGACATGAACAACCCCCTGTCTCATTACTGGATCTCCTCGTCACA
TAACACGTACCTTACAGGTGACCAGCTGCGGAGCGAGTCGTCCCCAGAAGCTTACATCCGCTGCCTGCGC
ATGGGCTGTCGCTGCATTGAACTGGACTGCTGGGACGGGCCCGATGGGAAGCCGGTCATCTACCATGGCT
GGACGCGGACTACCAAGATCAAGTTTGACGACGTCGTGCAGGCCATCAAAGACCACGCCTTTGTTACGTC
GAGCTTCCCAGTGATCCTGTCCATCGAGGAGCACTGCAGCGTGGAGCAACAGCGTCACATGGCCAAGGCC
TTCAAGGAAGTATTTGGCGACCTGCTGTTGACGAAGCCCACGGAGGCCAGTGCTGACCAGCTGCCCTCGC
CCAGCCAGCTGCGGGAGAAGATCATCATCAAGCATAAGAAGCTGGGCCCCCGAGGCGATGTGGATGTCAA
CATGGAGGACAAGAAGGACGAACACAAGCAACAGGGGGAGCTGTACATGTGGGATTCCATTGACCAGAAA
TGGACTCGGCACTACTGCGCCATTGCCGATGCCAAGCTGTCCTTCAGTGATGACATTGAACAGACTATGG
AGGAGGAAGTGCCCCAGGATATACCCCCTACAGAACTACATTTTGGGGAGAAATGGTTCCACAAGAAGGT
GGAGAAGAGGACGAGTGCCGAGAAGTTGCTGCAGGAATACTGCATGGAGACGGGGGGCAAGGATGGCACC
TTCCTGGTTCGGGAGAGCGAGACCTTCCCCAATGACTACACCCTGTCCTTCTGGCGGTCAGGCCGGGTCC
AGCACTGCCGGATCCGCTCCACCATGGAGGGCGGGACCCTGAAATACTACTTGACTGACAACCTCACCTT
CAGCAGCATCTATGCCCTCATCCAGCACTACCGCGAGACGCACCTGCGCTGCGCCGAGTTCGAGCTGCGG
CTCACGGACCCTGTGCCCAACCCCAACCCCCACGAGTCCAAGCCGTGGTACTATGACAGCCTGAGCCGCG
GAGAGGCAGAGGACATGCTGATGAGGATTCCCCGGGACGGGGCCTTCCTGATCCGGAAGCGAGAGGGGAG
CGACTCCTATGCCATCACCTTCAGGGCTAGGGGCAAGGTAAAGCATTGTCGCATCAACCGGGACGGCCGG
CACTTTGTGCTGGGGACCTCCGCCTATTTTGAGAGTCTGGTGGAGCTCGTCAGTTACTACGAGAAGCATT
CACTCTACCGAAAGATGAGACTGCGCTACCCCGTGACCCCCGAGCTCCTGGAGCGCTACAATATGGAAAG
AGATATAAACTCCCTCTACGACGTCAGCAGAATGTATGTGGATCCCAGTGAAATCAATCCGTCCATGCCT
CAGAGAACCGTGAAAGCTCTGTATGACTACAAAGCCAAGCGAAGCGATGAGCTGAGCTTCTGCCGTGGTG
CCCTCATCCACAATGTCTCCAAGGAGCCCGGGGGCTGGTGGAAAGGAGACTATGGAACCAGGATCCAGCA
GTACTTCCCATCCAACTACGTCGAGGACATCTCAACTGCAGACTTCGAGGAGCTAGAAAAGCAGATTATT
GAAGACAATCCCTTAGGGTCTCTTTGCAGAGGAATATTGGACCTCAATACCTATAACGTCGTGAAAGCCC
CTCAGGGAAAAAACCAGAAGTCCTTTGTCTTCATCCTGGAGCCCAAGCAGCAGGGCTATCCTCCGGTGGA
GTTTGCCACAGACAGGGTGGAGGAGCTCTTTGAGTGGTTTCAGAGCATCCGAGAGATCACCTGGAAGATT
GACACCAAGGAGAACAACATGAAGTACTGGGAGAAGAACCAGTCCATCGCCATCGAGCTCTCTGACCTGG
TTGTCTACTGCAAACCAACCAGCAAAACCAAGGACAACTTAGAAAATCCTGACTTCCGAGAAATCCGCTC
CTTTGTGGAGACGAAGGCTGACAGCATCATCAGACAGAAGCCCGTCGACCTCCTGAAGTACAATCAAAAG
GGCCTGACCCGCGTCTACCCAAAGGGACAAAGAGTTGACTCTTCAAACTACGACCCCTTCCGCCTCTGGC
TGTGCGGTTCTCAGATGGTGGCACTCAATTTCCAGACGGCAGATAAGTACATGCAGATGAATCACGCATT
GTTTTCTCTCAACGGGCGCACGGGCTACGTTCTGCAGCCTGAGAGCATGAGGACAGAGAAATATGACCCG
ATGCCACCCGAGTCCCAGAGGAAGATCCTGATGACGCTGACAGTCAAGGTTCTCGGTGCTCGCCATCTCC
CCAAACTTGGACGAAGTATTGCCTGTCCCTTTGTAGAAGTGGAGATCTGTGGAGCCGAGTATGACAACAA
CAAGTTCAAGACGACGGTTGTGAATGATAATGGCCTCAGCCCTATCTGGGCTCCAACACAGGAGAAGGTG
ACATTTGAAATTTATGACCCAAACCTGGCATTTCTGCGCTTTGTGGTTTATGAAGAAGATATGTTCAGCG
ATCCCAACTTTCTTGCTCATGCCACTTACCCCATTAAAGCAGTCAAATCAGGATTCAGGTCCGTTCCTCT
GAAGAATGGGTACAGCGAGGACATAGAGCTGGCTTCCCTCCTGGTTTTCTGTGAGATGCGGCCAGTCCTG
GAGAGCGAAGAGGAACTTTACTCCTCCTGTCGCCAGCTGAGGAGGCGGCAAGAAGAACTGAACAACCAGC
TCTTTCTGTATGACACACACCAGAACTTGCGCAATGCCAACCGGGATGCCCTGGTTAAAGAGTTCAGTGT
TAATGAGAACCAGCTCCAGCTGTACCAGGAGAAATGCAACAAGAGGTTAAGAGAGAAGAGAGTCAGCAAC
AGCAAGTTTTACTCA


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>RG200442 representing NM_002661
Red=Cloning site Green=Tags(s)

MSTTVNVDSLAEYEKSQIKRALELGTVMTVFSFRKSTPERRTVQVIMETRQVAWSKTADKIEGFLDIMEI
KEIRPGKNSKDFERAKAVRQKEDCCFTILYGTQFVLSTLSLAADSKEDAVNWLSGLKILHQEAMNASTPT
IIESWLRKQIYSVDQTRRNSISLRELKTILPLINFKVSSAKFLKDKFVEIGAHKDELSFEQFHLFYKKLM
FEQQKSILDEFKKDSSVFILGNTDRPDASAVYLRDFQRFLIHEQQEHWAQDLNKVRERMTKFIDDTMRET
AEPFLFVDEFLTYLFSRENSIWDEKYDAVDMQDMNNPLSHYWISSSHNTYLTGDQLRSESSPEAYIRCLR
MGCRCIELDCWDGPDGKPVIYHGWTRTTKIKFDDVVQAIKDHAFVTSSFPVILSIEEHCSVEQQRHMAKA
FKEVFGDLLLTKPTEASADQLPSPSQLREKIIIKHKKLGPRGDVDVNMEDKKDEHKQQGELYMWDSIDQK
WTRHYCAIADAKLSFSDDIEQTMEEEVPQDIPPTELHFGEKWFHKKVEKRTSAEKLLQEYCMETGGKDGT
FLVRESETFPNDYTLSFWRSGRVQHCRIRSTMEGGTLKYYLTDNLTFSSIYALIQHYRETHLRCAEFELR
LTDPVPNPNPHESKPWYYDSLSRGEAEDMLMRIPRDGAFLIRKREGSDSYAITFRARGKVKHCRINRDGR
HFVLGTSAYFESLVELVSYYEKHSLYRKMRLRYPVTPELLERYNMERDINSLYDVSRMYVDPSEINPSMP
QRTVKALYDYKAKRSDELSFCRGALIHNVSKEPGGWWKGDYGTRIQQYFPSNYVEDISTADFEELEKQII
EDNPLGSLCRGILDLNTYNVVKAPQGKNQKSFVFILEPKQQGYPPVEFATDRVEELFEWFQSIREITWKI
DTKENNMKYWEKNQSIAIELSDLVVYCKPTSKTKDNLENPDFREIRSFVETKADSIIRQKPVDLLKYNQK
GLTRVYPKGQRVDSSNYDPFRLWLCGSQMVALNFQTADKYMQMNHALFSLNGRTGYVLQPESMRTEKYDP
MPPESQRKILMTLTVKVLGARHLPKLGRSIACPFVEVEICGAEYDNNKFKTTVVNDNGLSPIWAPTQEKV
TFEIYDPNLAFLRFVVYEEDMFSDPNFLAHATYPIKAVKSGFRSVPLKNGYSEDIELASLLVFCEMRPVL
ESEEELYSSCRQLRRRQEELNNQLFLYDTHQNLRNANRDALVKEFSVNENQLQLYQEKCNKRLREKRVSN
SKFYS

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag TurboGFP
ACCN NM_002661
ORF Size 3795 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_002661.2, NP_002652.2
RefSeq Size 4263 bp
RefSeq ORF 3798 bp
Locus ID 5336
Cytogenetics 16q23.3
Domains C2, PI-PLC-X, SH2, SH3, PI-PLC-Y, PH
Protein Families Druggable Genome
Protein Pathways B cell receptor signaling pathway, Calcium signaling pathway, Epithelial cell signaling in Helicobacter pylori infection, ErbB signaling pathway, Fc epsilon RI signaling pathway, Fc gamma R-mediated phagocytosis, Glioma, Inositol phosphate metabolism, Leukocyte transendothelial migration, Metabolic pathways, Natural killer cell mediated cytotoxicity, Neurotrophin signaling pathway, Non-small cell lung cancer, Pathways in cancer, Phosphatidylinositol signaling system, VEGF signaling pathway, Vibrio cholerae infection
Gene Summary The protein encoded by this gene is a transmembrane signaling enzyme that catalyzes the conversion of 1-phosphatidyl-1D-myo-inositol 4,5-bisphosphate to 1D-myo-inositol 1,4,5-trisphosphate (IP3) and diacylglycerol (DAG) using calcium as a cofactor. IP3 and DAG are second messenger molecules important for transmitting signals from growth factor receptors and immune system receptors across the cell membrane. Mutations in this gene have been found in autoinflammation, antibody deficiency, and immune dysregulation syndrome and familial cold autoinflammatory syndrome 3. [provided by RefSeq, Mar 2014]

Citations (1)

Other Versions

Other products for "PLCG2"
Frequently bought together (3)
pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
    • 10 ug

USD 640.00


Mouse monoclonal turboGFP antibody, clone OTI2H8
    • 100 ul

USD 310.00


Anti-PLCG2 (Phospho-Tyr753) Rabbit Polyclonal Antibody
    • 100 ul

USD 345.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
68 Mouse Clones
Molbio tools