NFAT4 (NFATC3) (NM_173165) Human Tagged ORF Clone

CAT#: RG200357

Reviews ()
Write a review
  • TrueORF®

NFATC3 (GFP-tagged) - Human nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 3 (NFATC3), transcript variant 1



  "NM_173165" in other vectors (6)

Reward yourself with an Amazon® Card when get any 3 cDNA clones.

USD 1,070.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name NFAT4 (NFATC3) (NM_173165) Human Tagged ORF Clone
Type Human Tagged ORF Clone
Tag TurboGFP
Symbol NFATC3
Synonyms NF-AT4c; NFAT4; NFATX
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Cell Selection Neomycin
Sequence Data
>RG200357 representing NM_173165
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGACTACTGCAAACTGTGGCGCCCACGACGAGCTCGACTTCAAACTCGTCTTTGGCGAGGACGGGGCGC
CGGCGCCGCCGCCCCCGGGCTCGCGGCCTGCAGATCTTGAGCCAGATGATTGTGCATCCATTTACATCTT
TAATGTAGATCCACCTCCATCTACTTTAACCACACCACTTTGCTTACCACATCATGGATTACCGTCTCAC
TCTTCTGTTTTGTCACCATCGTTTCAGCTCCAAAGTCACAAAAACTATGAAGGAACTTGTGAGATTCCTG
AATCTAAATATAGCCCATTAGGTGGTCCCAAACCCTTTGAGTGCCCAAGTATTCAAATTACATCTATCTC
TCCTAACTGTCATCAAGAATTAGATGCACATGAAGATGACCTACAGATAAATGACCCAGAACGGGAATTT
TTGGAAAGGCCTTCTAGAGATCATCTCTATCTTCCTCTTGAGCCATCCTACCGGGAGTCTTCTCTTAGTC
CTAGTCCTGCCAGCAGCATCTCTTCTAGGAGTTGGTTCTCTGATGCATCTTCTTGTGAATCGCTTTCACA
TATTTATGATGATGTGGACTCAGAGTTGAATGAAGCTGCAGCCCGATTTACCCTTGGATCCCCTCTGACT
TCTCCTGGTGGCTCTCCAGGGGGCTGCCCTGGAGAAGAAACTTGGCATCAACAGTATGGACTTGGACACT
CATTATCACCCAGGCAATCTCCTTGCCACTCTCCTAGATCCAGTGTCACTGATGAGAATTGGCTGAGCCC
CAGGCCAGCCTCAGGACCCTCATCAAGGCCCACATCCCCCTGTGGGAAACGGAGGCACTCCAGTGCTGAA
GTTTGTTATGCTGGGTCCCTTTCACCCCATCACTCACCTGTTCCTTCACCTGGTCACTCCCCCAGGGGAA
GTGTGACAGAAGATACGTGGCTCAATGCTTCTGTCCATGGTGGGTCAGGCCTTGGCCCTGCAGTTTTTCC
ATTTCAGTACTGTGTAGAGACTGACATCCCTCTCAAAACAAGGAAAACTTCTGAAGATCAAGCTGCCATA
CTACCAGGAAAATTAGAGCTGTGTTCAGATGACCAAGGGAGTTTATCACCAGCCCGGGAGACTTCAATAG
ATGATGGCCTTGGATCTCAGTATCCTTTAAAGAAAGATTCATGTGGTGATCAGTTTCTTTCAGTTCCTTC
ACCCTTTACCTGGAGCAAACCAAAGCCTGGCCACACCCCTATATTTCGCACATCTTCATTACCTCCACTA
GACTGGCCTTTACCAGCTCATTTTGGACAATGTGAACTGAAAATAGAAGTGCAACCTAAAACTCATCATC
GAGCCCATTATGAAACTGAAGGTAGCCGAGGGGCAGTAAAAGCATCTACTGGGGGACATCCTGTTGTGAA
GCTCCTGGGCTATAACGAAAAGCCAATAAATCTACAAATGTTTATTGGGACAGCAGATGATCGATATTTA
CGACCTCATGCATTTTACCAGGTGCATCGAATCACTGGGAAGACAGTCGCTACTGCAAGCCAAGAGATAA
TAATTGCCAGTACAAAAGTTCTGGAAATTCCACTTCTTCCTGAAAATAATATGTCAGCCAGTATTGATTG
TGCAGGTATTTTGAAACTCCGCAATTCAGATATAGAACTTCGAAAAGGAGAAACTGATATTGGCAGAAAG
AATACTAGAGTACGACTTGTGTTTCGTGTACACATCCCACAGCCCAGTGGAAAAGTCCTTTCTCTGCAGA
TAGCCTCTATACCCGTTGAGTGCTCCCAGCGGTCTGCTCAAGAACTTCCTCATATTGAGAAGTACAGTAT
CAACAGTTGTTCTGTAAATGGAGGTCATGAAATGGTTGTGACTGGATCTAATTTTCTTCCAGAATCCAAA
ATCATTTTTCTTGAAAAAGGACAAGATGGACGACCTCAGTGGGAGGTAGAAGGGAAGATAATCAGGGAAA
AATGTCAAGGGGCTCACATTGTCCTTGAAGTTCCTCCATATCATAACCCAGCAGTTACAGCTGCAGTGCA
GGTGCACTTTTATCTTTGCAATGGCAAGAGGAAAAAAAGCCAGTCTCAACGTTTTACTTATACACCAGTT
TTGATGAAGCAAGAACACAGAGAAGAGATTGATTTGTCTTCAGTTCCATCTTTGCCTGTGCCTCATCCTG
CTCAGACCCAGAGGCCTTCCTCTGATTCAGGGTGTTCACATGACAGTGTACTGTCAGGACAGAGAAGTTT
GATTTGCTCCATCCCACAAACATATGCATCCATGGTGACCTCATCCCATCTGCCACAGTTGCAGTGTAGA
GATGAGAGTGTTAGTAAAGAACAGCATATGATTCCTTCTCCAATTGTACACCAGCCTTTTCAAGTCACAC
CAACACCTCCTGTGGGGTCTTCCTATCAGCCTATGCAAACTAATGTTGTGTACAATGGACCAACTTGTCT
TCCTATTAATGCTGCCTCTAGTCAAGAATTTGATTCAGTTTTGTTTCAGCAGGATGCAACTCTTTCTGGT
TTAGTGAATCTTGGCTGTCAACCACTGTCATCCATACCATTTCATTCTTCAAATTCAGGCTCAACAGGAC
ATCTCTTAGCCCATACACCTCATTCTGTGCATACCCTGCCTCATCTGCAATCAATGGGATATCATTGTTC
AAATACAGGACAAAGATCTCTTTCTTCTCCAGTGGCTGACCAGATTACAGGTCAGCCTTCGTCTCAGTTA
CAACCTATTACATATGGTCCTTCACATTCAGGGTCTGCTACAACAGCTTCCCCAGCAGCTTCTCATCCCT
TGGCTAGTTCACCGCTTTCTGGGCCACCATCTCCTCAGCTTCAGCCTATGCCTTACCAATCTCCTAGCTC
AGGAACTGCCTCATCACCGTCTCCAGCCACCAGAATGCATTCTGGACAGCACTCAACTCAAGCACAAAGT
ACGGGCCAGGGGGGTCTTTCTGCACCTTCATCCTTAATATGTCACAGTTTGTGTGATCCAGCGTCATTTC
CACCTGATGGGGCAACTGTGAGCATTAAACCTGAACCAGAAGATCGAGAGCCTAACTTTGCAACCATTGG
TCTGCAGGACATCACTTTAGATGATGTGAACGAGATAATTGGGAGAGACATGTCCCAGATTTCTGTTTCC
CAAGGAGCAGGGGTGAGCAGGCAGGCTCCCCTCCCGAGTCCTGAGTCCCTGGATTTAGGAAGATCTGATG
GGCTC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>RG200357 representing NM_173165
Red=Cloning site Green=Tags(s)

MTTANCGAHDELDFKLVFGEDGAPAPPPPGSRPADLEPDDCASIYIFNVDPPPSTLTTPLCLPHHGLPSH
SSVLSPSFQLQSHKNYEGTCEIPESKYSPLGGPKPFECPSIQITSISPNCHQELDAHEDDLQINDPEREF
LERPSRDHLYLPLEPSYRESSLSPSPASSISSRSWFSDASSCESLSHIYDDVDSELNEAAARFTLGSPLT
SPGGSPGGCPGEETWHQQYGLGHSLSPRQSPCHSPRSSVTDENWLSPRPASGPSSRPTSPCGKRRHSSAE
VCYAGSLSPHHSPVPSPGHSPRGSVTEDTWLNASVHGGSGLGPAVFPFQYCVETDIPLKTRKTSEDQAAI
LPGKLELCSDDQGSLSPARETSIDDGLGSQYPLKKDSCGDQFLSVPSPFTWSKPKPGHTPIFRTSSLPPL
DWPLPAHFGQCELKIEVQPKTHHRAHYETEGSRGAVKASTGGHPVVKLLGYNEKPINLQMFIGTADDRYL
RPHAFYQVHRITGKTVATASQEIIIASTKVLEIPLLPENNMSASIDCAGILKLRNSDIELRKGETDIGRK
NTRVRLVFRVHIPQPSGKVLSLQIASIPVECSQRSAQELPHIEKYSINSCSVNGGHEMVVTGSNFLPESK
IIFLEKGQDGRPQWEVEGKIIREKCQGAHIVLEVPPYHNPAVTAAVQVHFYLCNGKRKKSQSQRFTYTPV
LMKQEHREEIDLSSVPSLPVPHPAQTQRPSSDSGCSHDSVLSGQRSLICSIPQTYASMVTSSHLPQLQCR
DESVSKEQHMIPSPIVHQPFQVTPTPPVGSSYQPMQTNVVYNGPTCLPINAASSQEFDSVLFQQDATLSG
LVNLGCQPLSSIPFHSSNSGSTGHLLAHTPHSVHTLPHLQSMGYHCSNTGQRSLSSPVADQITGQPSSQL
QPITYGPSHSGSATTASPAASHPLASSPLSGPPSPQLQPMPYQSPSSGTASSPSPATRMHSGQHSTQAQS
TGQGGLSAPSSLICHSLCDPASFPPDGATVSIKPEPEDREPNFATIGLQDITLDDVNEIIGRDMSQISVS
QGAGVSRQAPLPSPESLDLGRSDGL

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_173165
ORF Size 3225 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_173165.1, NP_775188.1
RefSeq Size 3901 bp
RefSeq ORF 3228 bp
Locus ID 4775
Cytogenetics 16q22.1
Protein Families Druggable Genome, Transcription Factors
Protein Pathways Axon guidance, B cell receptor signaling pathway, Natural killer cell mediated cytotoxicity, T cell receptor signaling pathway, VEGF signaling pathway, Wnt signaling pathway
Gene Summary The product of this gene is a member of the nuclear factors of activated T cells DNA-binding transcription complex. This complex consists of at least two components: a preexisting cytosolic component that translocates to the nucleus upon T cell receptor (TCR) stimulation and an inducible nuclear component. Other members of this family participate to form this complex also. The product of this gene plays a role in the regulation of gene expression in T cells and immature thymocytes. Several transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq, Nov 2010]

Other Versions

Other products for "NFATC3"
Frequently bought together (3)
pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
    • 10 ug

USD 640.00


Mouse monoclonal turboGFP antibody, clone OTI2H8
    • 100 ul

USD 310.00


Rabbit Polyclonal NFAT4 (Ser165) Antibody (Phospho-specific)
    • 100 ul

USD 345.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
68 Mouse Clones
Molbio tools