DDAH2 (NM_013974) Human Tagged ORF Clone

CAT#: RG200287

DDAH2 (GFP-tagged) - Human dimethylarginine dimethylaminohydrolase 2 (DDAH2)

Clone Modification / Custom Cloning Service

  • TrueORF®

USD 546.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name DDAH2 (NM_013974) Human Tagged ORF Clone
Symbol DDAH2
Synonyms DDAH; DDAHII; G6a; HEL-S-277; NG30
Vector pCMV6-AC-GFP
Sequence Data
ORF Nucleotide Sequence
>RG200287 representing NM_013974
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGGACGCCGGGGGAGGGGCTGGGCCGCTGCTCCCATGCCCTGATCCGGGGAGTCCCAGAGAGCCTGG
CGTCGGGGGAAGGTGCGGGGGCTGGCCTTCCCGCTCTGGATCTGGCCAAAGCTCAAAGGGAGCACGGGGT
GCTGGGAGGTAAACTGAGGCAACGACTGGGGCTACAGCTGCTAGAACTGCCACCTGAGGAGTCATTGCCG
CTGGGACCGCTGCTTGGCGACACGGCCGTGATCCAAGGGGACACGGCCCTAATCACGCGGCCCTGGAGCC
CCGCTCGTAGGCCAGAGGTCGATGGAGTCCGCAAAGCCCTGCAAGACCTGGGGCTCCGAATTGTGGAAAT
AGGAGACGAGAACGCGACGCTGGATGGCACTGACGTTCTCTTCACCGGCCGGGAGTTTTTCGTAGGCCTC
TCCAAATGGACCAATCACCGAGGAGCTGAGATCGTGGCGGACACGTTCCGGGACTTCGCCGTCTCCACTG
TGCCAGTCTCGGGTCCCTCCCACCTGCGCGGTCTCTGCGGCATGGGGGGACCTCGCACTGTTGTGGCAGG
CAGCAGCGACGCTGCCCAAAAGGCTGTCCGGGCAATGGCAGTGCTGACAGATCACCCATATGCCTCCCTG
ACCCTCCCAGATGACGCAGCTGCTGACTGTCTCTTTCTTCGTCCTGGGTTGCCTGGTGTGCCCCCTTTCC
TCCTGCACCGTGGAGGTGGGGATCTGCCCAACAGCCAGGAGGCACTGCAGAAGCTCTCTGATGTCACCCT
GGTACCTGTGTCCTGCTCAGAACTGGAGAAGGCTGGCGCCGGGCTCAGCTCCCTCTGCTTGGTGCTCAGC
ACACGCCCCCACAGC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG200287 representing NM_013974
Red=Cloning site Green=Tags(s)

MGTPGEGLGRCSHALIRGVPESLASGEGAGAGLPALDLAKAQREHGVLGGKLRQRLGLQLLELPPEESLP
LGPLLGDTAVIQGDTALITRPWSPARRPEVDGVRKALQDLGLRIVEIGDENATLDGTDVLFTGREFFVGL
SKWTNHRGAEIVADTFRDFAVSTVPVSGPSHLRGLCGMGGPRTVVAGSSDAAQKAVRAMAVLTDHPYASL
TLPDDAAADCLFLRPGLPGVPPFLLHRGGGDLPNSQEALQKLSDVTLVPVSCSELEKAGAGLSSLCLVLS
TRPHS

TRTRRLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag TurboGFP
ACCN NM_013974
ORF Size 855 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_013974.1, NP_039268
RefSeq Size 1351
RefSeq ORF 858
Locus ID 23564
Cytogenetics 6p21.33
Domains Amidinotransf
Gene Summary This gene encodes a dimethylarginine dimethylaminohydrolase. The encoded enzyme functions in nitric oxide generation by regulating the cellular concentrations of methylarginines, which in turn inhibit nitric oxide synthase activity. The protein may be localized to the mitochondria. Alternative splicing resulting in multiple transcript variants. [provided by RefSeq, Dec 2014]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)