AATF (NM_012138) Human Tagged ORF Clone

CAT#: RG200070

AATF (GFP-tagged) - Human apoptosis antagonizing transcription factor (AATF)

Change vector?

  • TrueORF®

USD 629.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name AATF (NM_012138) Human Tagged ORF Clone
Symbol AATF
Synonyms BFR2; CHE-1; CHE1; DED
Vector pCMV6-AC-GFP
Sequence Data
ORF Nucleotide Sequence
>RG200070 representing NM_012138
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGGGGCCGCAGCCCCTGGCGCTGCAACTGGAACAGTTGTTGAACCCGCGACCAAGCGAGGCGGACC
CTGAAGCGGACCCCGAGGAAGCCACTGCTGCCAGGGTGATTGACAGGTTTGATGAAGGGGAAGATGGGGA
AGGTGATTTCCTAGTAGTGGGTAGCATTAGAAAACTGGCATCAGCCTCCCTCTTGGACACGGACAAAAGG
TATTGCGGCAAAACCACCTCTAGAAAAGCATGGAATGAAGACCATTGGGAGCAGACTCTGCCAGGATCGT
CTGATGAGGAAATATCTGATGAGGAAGGGTCTGGAGATGAAGATTCAGAGGGACTGGGTCTGGAGGAATA
TGATGAGGACGACCTGGGTGCTGCTGAGGAACAGGAGTGTGGTGATCACAGGGAGAGCAAGAAGAGCAGA
AGCCACTCTGCAAAAACACCGGGCTTCAGTGTCCAGAGTATCAGTGACTTTGAGAAATTTACCAAGGGAA
TGGATGACCTTGGGAGCAGTGAGGAGGAGGAAGACGAAGAGAGTGGCATGGAAGAAGGGGATGACGCGGA
AGACTCCCAAGGCGAGAGTGAGGAAGACAGGGCTGGAGATAGAAACAGTGAGGATGATGGTGTGGTGATG
ACCTTCTCTAGTGTCAAAGTTTCTGAGGAAGTGGAGAAAGGAAGAGCCGTGAAGAACCAGATAGCACTGT
GGGACCAGCTCTTGGAAGGAAGGATCAAACTACAAAAAGCTCTGTTGACCACCAACCAGCTTCCTCAACC
AGATGTTTTCCCATTGTTCAAGGACAAAGGTGGCCCAGAATTTTCCAGTGCCCTGAAAAATAGTCACAAG
GCACTTAAAGCATTGTTGAGGTCATTGGTAGGTCTTCAGGAAGAGTTGCTTTTCCAGTACCCAGACACTA
GATATCTAGTAGATGGGACAAAGCCCAATGCGGGAAGTGAGGAGATTTCTAGTGAAGATGATGAGCTGGT
AGAAGAGAAGAAGCAGCAACGAAGAAGGGTCCCTGCAAAGAGGAAGCTGGAGATGGAGGACTATCCCAGC
TTCATGGCAAAGCGCTTTGCCGACTTTACAGTCTACAGGAACCGCACACTTCAGAAATGGCACGATAAGA
CCAAACTGGCTTCTGGAAAACTGGGGAAGGGTTTTGGTGCCTTTGAACGCTCAATCTTGACTCAGATCGA
CCATATTCTGATGGACAAAGAGAGATTACTTCGAAGGACACAGACCAAGCGCTCTGTCTATCGAGTTCTT
GGCAAACCTGAGCCAGCAGCTCAGCCTGTCCCAGAGAGTTTGCCAGGGGAACCGGAGATCCTTCCTCAAG
CCCCTGCTAATGCTCATCTGAAGGACTTGGATGAAGAAATCTTTGATGATGATGACTTTTACCACCAGCT
CCTTCGAGAACTCATAGAACGGAAGACCAGCTCCTTGGATCCCAACGATCAGGTGGCCATGGGAAGGCAG
TGGCTTGCAATCCAGAAGTTACGAAGCAAAATCCACAAAAAAGTAGATAGGAAAGCCAGCAAAGGCAGGA
AACTTCGGTTTCATGTCCTTAGCAAGCTACTGAGTTTCATGGCACCTATTGACCATACTACAATGAATGA
TGATGCCAGGACAGAACTGTACCGCTCTCTTTTTGGCCAGCTCCACCCTCCCGACGAAGGCCACGGGGAT


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG200070 representing NM_012138
Red=Cloning site Green=Tags(s)

MAGPQPLALQLEQLLNPRPSEADPEADPEEATAARVIDRFDEGEDGEGDFLVVGSIRKLASASLLDTDKR
YCGKTTSRKAWNEDHWEQTLPGSSDEEISDEEGSGDEDSEGLGLEEYDEDDLGAAEEQECGDHRESKKSR
SHSAKTPGFSVQSISDFEKFTKGMDDLGSSEEEEDEESGMEEGDDAEDSQGESEEDRAGDRNSEDDGVVM
TFSSVKVSEEVEKGRAVKNQIALWDQLLEGRIKLQKALLTTNQLPQPDVFPLFKDKGGPEFSSALKNSHK
ALKALLRSLVGLQEELLFQYPDTRYLVDGTKPNAGSEEISSEDDELVEEKKQQRRRVPAKRKLEMEDYPS
FMAKRFADFTVYRNRTLQKWHDKTKLASGKLGKGFGAFERSILTQIDHILMDKERLLRRTQTKRSVYRVL
GKPEPAAQPVPESLPGEPEILPQAPANAHLKDLDEEIFDDDDFYHQLLRELIERKTSSLDPNDQVAMGRQ
WLAIQKLRSKIHKKVDRKASKGRKLRFHVLSKLLSFMAPIDHTTMNDDARTELYRSLFGQLHPPDEGHGD

TRTRRLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag TurboGFP
ACCN NM_012138
ORF Size 1680 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_012138.3, NP_036270
RefSeq Size 2172
Locus ID 26574
Cytogenetics 17q12
Protein Families Stem cell - Pluripotency, Transcription Factors, Druggable Genome
Gene Summary The protein encoded by this gene was identified on the basis of its interaction with MAP3K12/DLK, a protein kinase known to be involved in the induction of cell apoptosis. This gene product contains a leucine zipper, which is a characteristic motif of transcription factors, and was shown to exhibit strong transactivation activity when fused to Gal4 DNA binding domain. Overexpression of this gene interfered with MAP3K12 induced apoptosis. [provided by RefSeq, Jul 2008].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.