Junctional Adhesion Molecule 1(F11R) (NM_144504) Human Tagged ORF Clone

CAT#: RG200004

F11R (GFP-tagged) - Human F11 receptor (F11R), transcript variant 5

  • TrueORF®

Need custom modification / cloning service?
Get a free quote

USD 546.00


Availability*
In Stock

Size
    • 10 ug

Cited in 1 publication.

Product images

Specifications

Product Data
Product Name Junctional Adhesion Molecule 1(F11R) (NM_144504) Human Tagged ORF Clone
Symbol F11R
Synonyms JAM, KAT, JAM1, JAMA, JCAM, CD321, JAM-1, JAM-A, PAM-1
Vector pCMV6-AC-GFP
Sequence Data
>RG200004 representing NM_144504
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGGACAAAGGCGCAAGTCGAGAGGAAACTGTTGTGCCTCTTCATATTGGCGATCCTGTTGTGCTCCC
TGGCATTGGGCAGTGTTACAGTGCACTCTTCTGAACCTGAAGTCAGAATTCCTGAGAATAATCCTGTGAA
GTTGTCCTGTGCCTACTCGGGCTTTTCTTCTCCCCGTGTGGAGTGGAAGTTTGACCAAGGAGACACCACC
AGACTCGTTTGCTATAATAACAAGATCACAGCTTCCTATGAGGACCGGGTGACCTTCTTGCCAACTGGTA
TCACCTTCAAGTCCGTGACACGGGAAGACACTGGGACATACACTTGTATGGTCTCTGAGGAAGGCGGCAA
CAGCTATGGGGAGGTCAAGGTCAAGCTCATCGTGCTTGTGCCTCCATCCAAGCCTACAGTTAACATCCCC
TCCTCTGCCACCATTGGGAACCGGGCAGTGCTGACATGCTCAGAACAAGATGGTTCCCCACCTTCTGAAT
ACACCTGGTTCAAAGATGGGATAGTGATGCCTACGAATCCCAAAAGCACCCGTGCCTTCAGCAACTCTTC
CTATGTCCTGAATCCCACAACAGGAGAGCTGGTCTTTGATCCCCTGTCAGCCTCTGATACTGGAGAATAC
AGCTGTGAGGCACGGAATGGGTATGGGACACCCATGACTTCAAATGCTGTGCGCATGGAAGCTGTGGAGC
GGAATGTGGGGGTCATCGTGGCAGCCGTCCTTGTAACCCTGATTCTCCTGGGAATCTTGGTTTTTGGCAT
CTGGTTTGCCTATAGCCGAGGCCACTTTGACAGAACAAAGAAAGGGACTTCGAGTAAGAAGGTGATTTAC
AGCCAGCCTAGTGCCCGAAGTGAAGGAGAATTCAAACAGACCTCGTCATTCCTGGTG


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>RG200004 representing NM_144504
Red=Cloning site Green=Tags(s)

MGTKAQVERKLLCLFILAILLCSLALGSVTVHSSEPEVRIPENNPVKLSCAYSGFSSPRVEWKFDQGDTT
RLVCYNNKITASYEDRVTFLPTGITFKSVTREDTGTYTCMVSEEGGNSYGEVKVKLIVLVPPSKPTVNIP
SSATIGNRAVLTCSEQDGSPPSEYTWFKDGIVMPTNPKSTRAFSNSSYVLNPTTGELVFDPLSASDTGEY
SCEARNGYGTPMTSNAVRMEAVERNVGVIVAAVLVTLILLGILVFGIWFAYSRGHFDRTKKGTSSKKVIY
SQPSARSEGEFKQTSSFLV

TRTRRLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag TurboGFP
ACCN NM_144504
ORF Size 897 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_144504.1, NP_653087
RefSeq Size 3794
RefSeq ORF 899
Locus ID 50848
Cytogenetics 1q23.3
Domains ig, IGv, IGc2, IG
Protein Families Transmembrane, Druggable Genome
Protein Pathways Cell adhesion molecules (CAMs), Tight junction, Leukocyte transendothelial migration, Epithelial cell signaling in Helicobacter pylori infection
Gene Summary Tight junctions represent one mode of cell-to-cell adhesion in epithelial or endothelial cell sheets, forming continuous seals around cells and serving as a physical barrier to prevent solutes and water from passing freely through the paracellular space. The protein encoded by this immunoglobulin superfamily gene member is an important regulator of tight junction assembly in epithelia. In addition, the encoded protein can act as (1) a receptor for reovirus, (2) a ligand for the integrin LFA1, involved in leukocyte transmigration, and (3) a platelet receptor. Multiple 5' alternatively spliced variants, encoding the same protein, have been identified but their biological validity has not been established. [provided by RefSeq, Jul 2008]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)