RYK (NM_001005861) Human Tagged ORF Clone

CAT#: RC600067

RYK (DDK-His-tagged)-Extra Cellular Domain Clone of Homo sapiens receptor-like tyrosine kinase, transcript variant 1, Signal peptide (1-25) plus EC domain (26-224)

Specifications

Product Data

• Type: Human Tagged ORF Clone
• Tag: DDK-His
• Symbol: RYK
• Synonyms: D3S3195; JTK5; JTK5A; RYK1
• Vector: pCMV6-XL5-DDK-His
• E. coli Selection: Ampicillin (100 ug/mL)
• Mammalian Cell Selection: None
• Sequence Data:
  ORF Nucleotide Sequence

  >RC600067 representing leader sequence plus the extracellular domain region of NM_001005861
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  GTAATACGACTCACTATAGGGCGGCCGCGAATTCGTCGACTGGATCTGGTACCGAGGAGATCCGCCGCCG
  CGATCGCC
  
  ATGCGTGGGGCGGCGCGGCTGGGGCGGCCGGGCCGGAGTTGCCTCCCGGGGGCCCGCGGCCTGAGGGCCC
  CGCCGCCGCCGCCGCTGCTGCTTCTGCTTGCGCTGTTGCCGCTGCTGCCCGCGCCTGGCGCTGCCGCCGC
  CCCCGCCCCGCGGCCCCCGGAGCTGCAGTCGGCTTCCGCGGGGCCCAGCGTGAGTCTCTACCTGAGCGAG
  GACGAGGTGCGCCGGCTGATCGGTCTTGATGCAGAACTTTATTATGTGAGAAATGACCTTATTAGTCACT
  ACGCTCTATCCTTTAGTCTGTTAGTACCCAGTGAGACAAATTTCCTGCACTTCACCTGGCATGCGAAGTC
  CAAGGTTGAATATAAGCTGGGATTCCAAGTGGACAATGTTTTGGCAATGGATATGCCCCAGGTCAACATT
  TCTGTTCAGGGGGAAGTTCCACGCACTTTATCAGTGTTTCGGGTAGAGCTTTCCTGTACTGGCAAAGTAG
  ATTCTGAAGTTATGATACTAATGCAGCTCAACTTGACAGTAAATTCTTCAAAAAATTTTACCGTCTTAAA
  TTTTAAACGAAGGAAAATGTGCTACAAAAAACTTGAAGAAGTAAAAACTTCAGCCTTGGACAAAAACACT
  AGCAGAACTATTTATGATCCTGTACATGCAGCTCCAACCACTACGCGT
  
  AGCGGACCGACGCGTTCAGGCGACTACAAGGATGACGACGATAAGGGATCTCATCATCACCATCACCATT
  AATGAGATCTGGTACCGATATCAAGCTTGTCGACTCTAGA
  Protein Sequence

  >RC600067 representing signal peptide plus the extracellular domain region of NM_001005861
  Red=Cloning sites Green= DDK and 6XHIS Tags
  
  MRGAARLGRPGRSCLPGARGLRAPPPPPLLLLLALLPLLPAPGAAAAPAPRPPELQSASAGPSVSLYLSE
  DEVRRLIGLDAELYYVRNDLISHYALSFSLLVPSETNFLHFTWHAKSKVEYKLGFQVDNVLAMDMPQVNI
  SVQGEVPRTLSVFRVELSCTGKVDSEVMILMQLNLTVNSSKNFTVLNFKRRKMCYKKLEEVKTSALDKNT
  SRTIYDPVHAAPTTTR
  
  SGPTRTRSGDYKDDDDKGSHHHHHH
• Restriction Sites: SgfI-RsrII Cloning Scheme for this gene
• ACCN: NM_001005861
• ORF Size: 678 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the extra cellular domain of the protein with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_001005861.2, NP_001005861.1
• RefSeq Size: 2942 bp
• RefSeq ORF: 1833 bp
• Locus ID: 6259
• UniProt ID: P34925
• Cytogenetics: 3q22.2
• Protein Families: Druggable Genome, Protein Kinase, Transmembrane
• MW: 24.9 kDa
• Gene Summary: The protein encoded by this gene is an atypical member of the family of growth factor receptor protein tyrosine kinases, differing from other members at a number of conserved residues in the activation and nucleotide binding domains. This gene product belongs to a subfamily whose members do not appear to be regulated by phosphorylation in the activation segment. It has been suggested that mediation of biological activity by recruitment of a signaling-competent auxiliary protein may occur through an as yet uncharacterized mechanism. The encoded protein has a leucine-rich extracellular domain with a WIF-type Wnt binding region, a single transmembrane domain, and an intracellular tyrosine kinase domain. This protein is involved in stimulating Wnt signaling pathways such as the regulation of axon pathfinding. Alternative splicing results in multiple transcript variants encoding distinct isoforms. [provided by RefSeq, Feb 2012]