IGF1 Receptor (IGF1R) (NM_000875) Human Tagged ORF Clone

CAT#: RC600009

IGF1R (DDK-His-tagged)-Extra Cellular Domain Clone of Homo sapiens insulin-like growth factor 1 receptor, Signal peptide (1-30) plus EC domain (741-935)

Specifications

Product Data

• Type: Human Tagged ORF Clone
• Tag: DDK-His
• Symbol: IGF1 Receptor
• Synonyms: CD221; IGFIR; IGFR; JTK13
• Vector: pCMV6-XL5-DDK-His
• E. coli Selection: Ampicillin (100 ug/mL)
• Mammalian Cell Selection: None
• Sequence Data:
  ORF Nucleotide Sequence

  >RC600009 representing leader sequence plus the extracellular domain region of NM_000875
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  GTAATACGACTCACTATAGGGCGGCCGCGAATTCGTCGACTGGATCTGGTACCGAGGAGATCCGCCGCCG
  CGATCGCC
  
  ATGAAGTCTGGCTCCGGAGGAGGGTCCCCGACCTCGCTGTGGGGGCTCCTGTTTCTCTCCGCCGCGCTCT
  CGCTCTGGCCGACGAGTGGAGATGTCATGCAAGTGGCCAACACCACCATGTCCAGCCGAAGCAGGAACAC
  CACGGCCGCAGACACCTACAACATCACCGACCCGGAAGAGCTGGAGACAGAGTACCCTTTCTTTGAGAGC
  AGAGTGGATAACAAGGAGAGAACTGTCATTTCTAACCTTCGGCCTTTCACATTGTACCGCATCGATATCC
  ACAGCTGCAACCACGAGGCTGAGAAGCTGGGCTGCAGCGCCTCCAACTTCGTCTTTGCAAGGACTATGCC
  CGCAGAAGGAGCAGATGACATTCCTGGGCCAGTGACCTGGGAGCCAAGGCCTGAAAACTCCATCTTTTTA
  AAGTGGCCGGAACCTGAGAATCCCAATGGATTGATTCTAATGTATGAAATAAAATACGGATCACAAGTTG
  AGGATCAGCGAGAATGTGTGTCCAGACAGGAATACAGGAAGTATGGAGGGGCCAAGCTAAACCGGCTAAA
  CCCGGGGAACTACACAGCCCGGATTCAGGCCACATCTCTCTCTGGGAATGGGTCGTGGACAGATCCTGTG
  TTCTTCTATGTCCAGGCCAAAACAGGATATGAAAACTTCATCCAT
  
  ACGCGTTCAGGCGACTACAAGGATGACGACGATAAGGGATCTCATCATCACCATCACCATTAATGAGATC
  TGGTACCGATATCAAGCTTGTCGACTCTAGA
  Protein Sequence

  >RC600009 representing signal peptide plus the extracellular domain region of NM_000875
  Red=Cloning sites Green= DDK and 6XHIS Tags
  
  MKSGSGGGSPTSLWGLLFLSAALSLWPTSGDVMQVANTTMSSRSRNTTAADTYNITDPEELETEYPFFES
  RVDNKERTVISNLRPFTLYRIDIHSCNHEAEKLGCSASNFVFARTMPAEGADDIPGPVTWEPRPENSIFL
  KWPEPENPNGLILMYEIKYGSQVEDQRECVSRQEYRKYGGAKLNRLNPGNYTARIQATSLSGNGSWTDPV
  FFYVQAKTGYENFIH
  
  TRSGTRSGDYKDDDDKGSHHHHHH
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene
• ACCN: NM_000875
• ORF Size: 4104 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the extra cellular domain of the protein with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_000875.3, NP_000866.1
• RefSeq Size: 12235 bp
• RefSeq ORF: 4104 bp
• Locus ID: 3480
• UniProt ID: P08069
• Cytogenetics: 15q26.3
• Protein Families: Druggable Genome, Protein Kinase, Transmembrane
• Protein Pathways: Adherens junction, Colorectal cancer, Endocytosis, Focal adhesion, Glioma, Long-term depression, Melanoma, Oocyte meiosis, Pathways in cancer, Progesterone-mediated oocyte maturation, Prostate cancer
• MW: 25.2 kDa
• Gene Summary: This receptor binds insulin-like growth factor with a high affinity. It has tyrosine kinase activity. The insulin-like growth factor I receptor plays a critical role in transformation events. Cleavage of the precursor generates alpha and beta subunits. It is highly overexpressed in most malignant tissues where it functions as an anti-apoptotic agent by enhancing cell survival. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq, May 2014]