KCNT1 (NM_001272003) Human Tagged ORF Clone

CAT#: RC235220

Reviews ()
Write a review
  • TrueORF®

KCNT1 (Myc-DDK tagged) - Homo sapiens potassium channel, subfamily T, member 1 (KCNT1), transcript variant 2



  "NM_001272003" in other vectors (2)

Reconstitution Protocol

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 1,159.00


Availability*
8 Weeks

Size
    • 10 ug


Product images

Other products for "KCNT1"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol KCNT1
Synonyms bA100C15.2; DEE14; EIEE14; ENFL5; KCa4.1; SLACK; Slo2.2
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC235220 representing NM_001272003
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCCACTCCCTGACGGGGCGCGGACCCCGGGGGGCGTCTGCCGGGAGGCGCGCGGCGGGGGCTACACCA
ACCGGACCTTCGAGTTTGACGACGGCCAATGCGCCCCCAGGGTCCAGGTGGAGTTCTACGTCAACGAGAA
CACCTTCAAGGAGCGGCTCAAGCTGTTCTTCATCAAAAACCAAAGATCGAGCCTGAGGATCCGGCTGTTC
AACTTCTCCCTGAAGCTGCTCACCTGCCTGCTCTACATTGTGCGCGTCCTGCTCGATGACCCGGCCCTGG
GCATCGGATGCTGGGGCTGCCCAAAGCAGAACTACTCCTTCAATGACTCGTCCTCCGAGATCAACTGGGC
TCCTATTCTGTGGGTGGAGAGAAAGATGACACTGTGGGCGATCCAGGTCATCGTGGCCATAATAAGCTTC
CTGGAGACGATGCTTCTCATCTACCTCAGCTACAAAGGCAACATCTGGGAGCAGATCTTCCGCGTGTCCT
TCGTCCTGGAGATGATCAACACTCTGCCCTTCATCATCACGATCTTCTGGCCGCCGCTGCGGAACCTGTT
CATCCCCGTCTTTCTGAACTGCTGGCTGGCCAAGCACGCGCTGGAAAACATGATTAATGACTTCCACCGT
GCCATCCTGCGGACACAGTCAGCCATGTTCAACCAGGTCCTCATCCTCTTCTGCACCCTGCTGTGCCTCG
TTTTCACGGGGGGTTGCAGGACCTGCGGCATCCAGCACCTGGAGCGGGCGGGCGAGAACCTGTCCCTCCT
GACCTCCTTCTACTTCTGCATCGTCACCTTCTCCACCGTGGGCTACGGTGACGTCACGCCCAAGATCTGG
CCATCGCAGCTGCTGGTGGTCATCATGATCTGCGTGGCCCTCGTGGTGCTCCCACTGCAGTTCGAGGAGC
TCGTCTACCTCTGGATGGAGCGGCAGAAGTCAGGGGGCAACTACAGCCGCCACCGTGCGCAGACGGAGAA
GCACGTGGTCCTGTGTGTCAGCTCCCTCAAGATCGACCTTCTCATGGACTTCCTGAACGAGTTCTACGCC
CACCCCCGGCTCCAGGACTATTACGTGGTCATCCTGTGCCCCACGGAGATGGATGTCCAGGTGCGCAGAG
TCCTGCAGATCCCTCTGTGGTCCCAGCGGGTCATCTACCTCCAGGGCTCTGCACTCAAAGACCAGGACCT
CATGCGAGCCAAGATGGACAATGGGGAGGCCTGCTTCATCCTCAGCAGCAGGAACGAGGTGGACCGCACG
GCTGCAGACCACCAGACCATCCTGCGCGCCTGGGCCGTGAAGGACTTCGCCCCCAACTGCCCCCTCTACG
TCCAGATCCTCAAACCTGAAAACAAGTTTCACGTCAAGTTTGCTGACCACGTGGTGTGTGAGGAGGAGTG
CAAGTACGCCATGCTGGCGCTGAACTGCATCTGCCCGGCGACCTCCACCCTCATCACCCTGCTGGTGCAC
ACGTCCCGCGGCCAGGAGGGACAGGAGTCTCCGGAGCAGTGGCAGCGCATGTATGGGCGCTGCTCCGGCA
ACGAGGTGTACCACATCCGCATGGGTGACAGCAAGTTCTTCCGCGAGTACGAGGGCAAGAGCTTCACCTA
CGCGGCCTTCCACGCCCACAAGAAGTATGGCGTGTGCCTCATCGGGCTGAAGCGGGAGGACAACAAGAGC
ATCCTGCTGAACCCGGGGCCCCGGCACATCCTGGCCGCCTCTGACACCTGCTTCTACATCAACATCACCA
AGGAGGAGAACTCGGCCTTCATCTTCAAGCAGGAGGAGAAGCGGAAGAAGAGGGCCTTCTCGGGGCAGGG
GCTGCACGAGGGTCCGGCCCGCCTGCCCGTGCACAGCATCATCGCCTCCATGGGGACAGTGGCCATGGAC
CTGCAGGGCACAGAGCACCGGCCTACGCAGAGCGGCGGTGGGGGCGGGGGCAGCAAGCTGGCACTGCCCA
CGGAGAACGGCTCGGGCAGCCGGCGGCCCAGCATCGCGCCCGTCCTGGAACTGGCCGACAGCTCAGCCCT
GCTGCCCTGCGACCTGCTGAGCGACCAGTCGGAGGATGAGGTGACGCCGTCGGACGACGAGGGGCTCTCC
GTGGTAGAGTATGTGAAGGGCTACCCTCCCAACTCGCCCTACATCGGCAGCTCCCCAACCCTGTGCCACC
TCCTGCCTGTGAAAGCCCCCTTCTGCTGCCTGCGGCTGGACAAGGGCTGCAAGCACAACAGCTATGAAGA
CGCCAAGGCCTACGGGTTCAAGAACAAGCTGATCATCGTCTCGGCAGAGACGGCCGGCAATGGGCTGTAC
AACTTCATCGTGCCACTGCGGGCCTACTACAGATCCCGCAAGGAGCTGAACCCCATCGTGCTGCTGCTGG
ACAACAAGCCCGACCACCACTTCCTGGAAGCCATCTGCTGCTTCCCCATGGTCTACTACATGGAGGGCTC
TGTGGACAACCTGGACAGCCTGCTGCAGTGTGGCATCATCTATGCGGACAACCTGGTGGTGGTGGACAAG
GAGAGCACCATGAGCGCCGAGGAGGACTACATGGCGGACGCCAAGACCATCGTCAACGTGCAGACCATGT
TCCGGCTCTTCCCCAGCCTCAGCATCACCACGGAGCTCACCCACCCTTCCAACATGCGCTTCATGCAGTT
CCGCGCCAAGGACAGCTACTCTCTGGCTCTTTCCAAACTAGAAAAGAGGGAGCGAGAGAATGGCTCCAAC
CTGGCCTTCATGTTCCGCCTGCCGTTCGCCGCCGGCCGCGTCTTCAGCATCAGCATGTTGGACACACTGC
TCTACCAGTCCTTCGTGAAGGACTACATGATCACCATCACCCGGCTGCTGCTGGGCCTGGACACCACGCC
GGGCTCGGGGTACCTCTGTGCCATGAAAATCACCGAGGGCGACCTGTGGATCCGCACGTACGGCCGCCTC
TTCCAGAAGCTCTGCTCCTCCAGCGCCGAGATCCCCATTGGCATCTACCGGACAGAGAGCCACGTCTTCT
CCACCTCGGAGCCCCACGACCTCAGAGCCCAGTCCCAGATCTCGGTGAACGTGGAGGACTGTGAGGACAC
ACGGGAAGTGAAGGGGCCCTGGGGCTCCCGCGCTGGCACCGGAGGCAGCTCCCAGGGCCGCCACACGGGC
GGCGGTGACCCCGCAGAGCACCCACTGCTACGGCGCAAGAGCCTGCAGTGGGCCCGGAGGCTGAGCCGCA
AGGCGCCCAAGCAGGCAGGCCGGGCGGCGGCCGCGGAGTGGATCAGCCAGCAGCGCCTCAGCCTGTACCG
GCGCTCTGAGCGCCAGGAGCTCTCCGAGCTGGTGAAGAACCGCATGAAGCACCTGGGGCTGCCCACCACC
GGCTACGAGGACGTAGCAAATTTAACAGCCAGTGATGTCATGAATCGGGTAAACCTGGGATATTTGCAAG
ACGAGATGAACGACCACCAGAACACCCTCTCCTACGTCCTCATCAACCCTCCGCCCGACACGAGGCTGGA
GCCCAGTGACATTGTCTATCTCATCCGCTCCGACCCCCTGGCTCACGTGGCCAGCAGCTCCCAGAGCCGG
AAGAGCAGCTGCAGCCACAAGCTGTCGTCCTGCAACCCCGAGACTCGCGACGAGACACAGCTC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC235220 representing NM_001272003
Red=Cloning site Green=Tags(s)

MPLPDGARTPGGVCREARGGGYTNRTFEFDDGQCAPRVQVEFYVNENTFKERLKLFFIKNQRSSLRIRLF
NFSLKLLTCLLYIVRVLLDDPALGIGCWGCPKQNYSFNDSSSEINWAPILWVERKMTLWAIQVIVAIISF
LETMLLIYLSYKGNIWEQIFRVSFVLEMINTLPFIITIFWPPLRNLFIPVFLNCWLAKHALENMINDFHR
AILRTQSAMFNQVLILFCTLLCLVFTGGCRTCGIQHLERAGENLSLLTSFYFCIVTFSTVGYGDVTPKIW
PSQLLVVIMICVALVVLPLQFEELVYLWMERQKSGGNYSRHRAQTEKHVVLCVSSLKIDLLMDFLNEFYA
HPRLQDYYVVILCPTEMDVQVRRVLQIPLWSQRVIYLQGSALKDQDLMRAKMDNGEACFILSSRNEVDRT
AADHQTILRAWAVKDFAPNCPLYVQILKPENKFHVKFADHVVCEEECKYAMLALNCICPATSTLITLLVH
TSRGQEGQESPEQWQRMYGRCSGNEVYHIRMGDSKFFREYEGKSFTYAAFHAHKKYGVCLIGLKREDNKS
ILLNPGPRHILAASDTCFYINITKEENSAFIFKQEEKRKKRAFSGQGLHEGPARLPVHSIIASMGTVAMD
LQGTEHRPTQSGGGGGGSKLALPTENGSGSRRPSIAPVLELADSSALLPCDLLSDQSEDEVTPSDDEGLS
VVEYVKGYPPNSPYIGSSPTLCHLLPVKAPFCCLRLDKGCKHNSYEDAKAYGFKNKLIIVSAETAGNGLY
NFIVPLRAYYRSRKELNPIVLLLDNKPDHHFLEAICCFPMVYYMEGSVDNLDSLLQCGIIYADNLVVVDK
ESTMSAEEDYMADAKTIVNVQTMFRLFPSLSITTELTHPSNMRFMQFRAKDSYSLALSKLEKRERENGSN
LAFMFRLPFAAGRVFSISMLDTLLYQSFVKDYMITITRLLLGLDTTPGSGYLCAMKITEGDLWIRTYGRL
FQKLCSSSAEIPIGIYRTESHVFSTSEPHDLRAQSQISVNVEDCEDTREVKGPWGSRAGTGGSSQGRHTG
GGDPAEHPLLRRKSLQWARRLSRKAPKQAGRAAAAEWISQQRLSLYRRSERQELSELVKNRMKHLGLPTT
GYEDVANLTASDVMNRVNLGYLQDEMNDHQNTLSYVLINPPPDTRLEPSDIVYLIRSDPLAHVASSSQSR
KSSCSHKLSSCNPETRDETQL

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_001272003
ORF Size 3633 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_001272003.2
RefSeq Size 4696 bp
RefSeq ORF 3636 bp
Locus ID 57582
UniProt ID Q5JUK3
Cytogenetics 9q34.3
Protein Families Druggable Genome, Ion Channels: Potassium, Transmembrane
MW 137.4 kDa
Gene Summary Potassium channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. This gene encodes a sodium-activated potassium channel subunit which is thought to function in ion conductance and developmental signaling pathways. Mutations in this gene cause the early-onset epileptic disorders, malignant migrating partial seizures of infancy and autosomal dominant nocturnal frontal lobe epilepsy. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Dec 2012]

Other Versions

Frequently bought together (5)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 177.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


KCNT1 rabbit polyclonal antibody
    • 100 ul

USD 380.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.