NFIB (NM_001190738) Human Tagged ORF Clone

CAT#: RC231240

Reviews ()
Write a review

NFIB (Myc-DDK-tagged)-Human nuclear factor I/B (NFIB), transcript variant 2



Reconstitution Protocol

USD 457.00

In Stock*

Size
    • 10 ug

Product images

Other products for "NFIB"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol NFIB
Synonyms CTF; HMGIC/NFIB; MACID; NF-I/B; NF1-B; NFI-B; NFI-RED; NFIB2; NFIB3
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC231240 representing NM_001190738
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAAAGAATCCCAGTGTCTGTGGACTTCTGGGTTGTCTGCTGTGCAGTTCTGAAATGTAACCCTGGGA
TTCCTAAAAGAATGTCAACTCTGTGCTTTGGATTTTCTGATGAATTTCACCCATTCATCGAGGCACTTCT
TCCACATGTCCGTGCAATTGCCTATACTTGGTTCAACCTGCAGGCTCGAAAACGCAAGTACTTTAAAAAG
CATGAGAAGCGAATGTCAAAGGATGAAGAAAGAGCAGTCAAAGATGAGCTTCTCAGTGAAAAGCCTGAAA
TCAAACAGAAGTGGGCATCCAGGCTCCTTGCCAAACTGCGCAAAGATATTCGCCAGGAGTATCGAGAGGA
CTTTGTGCTCACCGTGACTGGCAAGAAGCACCCGTGCTGTGTCTTATCCAATCCCGACCAGAAGGGTAAG
ATTAGGAGAATCGACTGCCTGCGACAGGCAGACAAAGTCTGGCGTCTGGATCTAGTCATGGTGATCCTGT
TCAAAGGCATCCCCTTGGAAAGTACCGATGGAGAGCGGCTCATGAAATCCCCACATTGCACAAACCCAGC
ACTTTGTGTCCAGCCACATCATATCACAGTATCAGTTAAGGAGCTTGATTTGTTTTTGGCATACTACGTG
CAGGAGCAAGATTCTGGACAATCAGGAAGTCCAAGCCACAATGATCCTGCCAAGAATCCTCCAGGTTACC
TTGAGGATAGTTTTGTAAAATCTGGAGTCTTCAATGTATCAGAACTTGTAAGAGTATCCAGAACGCCCAT
AACCCAGGGAACTGGAGTCAACTTCCCAATTGGAGAAATCCCAAGCCAACCATACTATCATGACATGAAC
TCGGGGGTCAATCTTCAGAGGTCTCTGTCTTCTCCACCAAGCAGCAAAAGACCCAAAACTATATCCATAG
ATGAAAATATGGAACCAAGTCCTACAGGAGACTTTTACCCCTCTCCAAGTTCACCAGCTGCTGGAAGTCG
AACATGGCACGAAAGAGATCAAGATATGTCTTCTCCGACTACTATGAAGAAGCCTGAAAAGCCATTGTTC
AGCTCTGCATCTCCACAGGATTCTTCCCCAAGACTGAGCACTTTCCCCCAGCACCACCATCCCGGAATAC
CTGGAGTTGCACACAGTGTCATCTCAACTCGAACTCCACCTCCACCTTCACCGTTGCCATTTCCAACACA
AGCTATCCTTCCTCCAGCCCCATCGAGCTACTTTTCTCATCCAACAATCAGATATCCTCCCCACCTGAAT
CCTCAGGATACTCTGAAGAACTATGTACCTTCTTATGACCCATCCAGTCCACAAACCAGCCAGTCCTGGT
ACCTGGGC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC231240 representing NM_001190738
Red=Cloning site Green=Tags(s)

MERIPVSVDFWVVCCAVLKCNPGIPKRMSTLCFGFSDEFHPFIEALLPHVRAIAYTWFNLQARKRKYFKK
HEKRMSKDEERAVKDELLSEKPEIKQKWASRLLAKLRKDIRQEYREDFVLTVTGKKHPCCVLSNPDQKGK
IRRIDCLRQADKVWRLDLVMVILFKGIPLESTDGERLMKSPHCTNPALCVQPHHITVSVKELDLFLAYYV
QEQDSGQSGSPSHNDPAKNPPGYLEDSFVKSGVFNVSELVRVSRTPITQGTGVNFPIGEIPSQPYYHDMN
SGVNLQRSLSSPPSSKRPKTISIDENMEPSPTGDFYPSPSSPAAGSRTWHERDQDMSSPTTMKKPEKPLF
SSASPQDSSPRLSTFPQHHHPGIPGVAHSVISTRTPPPPSPLPFPTQAILPPAPSSYFSHPTIRYPPHLN
PQDTLKNYVPSYDPSSPQTSQSWYLG

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_001190738
ORF Size 1338 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_001190738.1, NP_001177667.1
RefSeq ORF 1341 bp
Locus ID 4781
UniProt ID O00712
Cytogenetics 9p23-p22.3
Protein Families Druggable Genome, Transcription Factors
MW 50.7 kDa
Gene Summary Recognizes and binds the palindromic sequence 5'-TTGGCNNNNNGCCAA-3' present in viral and cellular promoters and in the origin of replication of adenovirus type 2. These proteins are individually capable of activating transcription and replication.[UniProtKB/Swiss-Prot Function]
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.