CLEC2D (NM_001197317) Human Tagged ORF Clone

CAT#: RC230997

CLEC2D (Myc-DDK-tagged)-Human C-type lectin domain family 2, member D (CLEC2D), transcript variant 3

Clone Modification / Custom Cloning Service

  • TrueORF®

USD 402.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name CLEC2D (NM_001197317) Human Tagged ORF Clone
Symbol CLEC2D
Synonyms CLAX; LLT1; OCIL
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC230997 representing NM_001197317
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCATGACAGTAACAATGTGGAGAAAGACATTACACCATCTGAATTGCCTGCAAACCCAGCAATAAGAG
CTAACTGCCATCAAGAGCCATCAGTATGTCTTCAAGCTGCATGCCCAGAAAGCTGGATTGGTTTTCAAAG
AAAGTGTTTCTATTTTTCTGATGACACCAAGAACTGGACATCAAGTCAGAGGTTTTGTGACTCACAAGAT
GCTGATCTTGCTCAGGTTGAAAGCTTCCAGGAACTGAATTTCCTGTTGAGATATAAAGGCCCATCTGATC
ACTGGATTGGGCTGAGCAGAGAACAAGGCCAACCATGGAAATGGATAAATGGTACTGAATGGACAAGACA
GTTTCCTATCCTGGGAGCAGGAGAGTGTGCCTATTTGAATGACAAAGGTGCCAGTAGTGCCAGGCACTAC
ACAGAGAGGAAGTGGATTTGTTCCAAATCAGATATACATGTC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC230997 representing NM_001197317
Red=Cloning site Green=Tags(s)

MHDSNNVEKDITPSELPANPAIRANCHQEPSVCLQAACPESWIGFQRKCFYFSDDTKNWTSSQRFCDSQD
ADLAQVESFQELNFLLRYKGPSDHWIGLSREQGQPWKWINGTEWTRQFPILGAGECAYLNDKGASSARHY
TERKWICSKSDIHV

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_001197317
ORF Size 462 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_001197317.1, NM_001197317.2, NP_001184246
RefSeq ORF 465
Locus ID 29121
Cytogenetics 12p13.31
Protein Families Transmembrane, Druggable Genome
MW 18.2 kDa
Gene Summary This gene encodes a member of the natural killer cell receptor C-type lectin family. The encoded protein inhibits osteoclast formation and contains a transmembrane domain near the N-terminus as well as the C-type lectin-like extracellular domain. Several alternatively spliced transcript variants have been identified for this gene. [provided by RefSeq, Oct 2010]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.