CARD8 (NM_001184900) Human Tagged ORF Clone

CAT#: RC230245

Reviews ()
Write a review

CARD8 (Myc-DDK-tagged)-Human caspase recruitment domain family, member 8 (CARD8), transcript variant 1



Reconstitution Protocol

USD 500.00

In Stock*

Size
    • 10 ug

Product images

Other products for "CARD8"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol CARD8
Synonyms CARDINAL; DACAR; DAKAR; NDPP; NDPP1; TUCAN
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC230245 representing NM_001184900
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAAAAAAAGGAGTGTCCAGAAAAGAGTAGCAGCAGTGAGGAAGAGCTGCCGAGACGGGACAGTGGAT
CCAGTAGGAACATAGATGCATCCAAACTCATTAGACTACAAGGATCACGGAAACTGTTGGTTGACAATAG
CATACGGGAACTGCAATACACAAAAACTGGAATTTTTTTTCAGGCTGAGGCCTGTGTGACAAATGATACG
GTATACAGGGAGCTACCCTGTGTTTCTGAGACCCTTTGTGACATCTCACATTTTTTCCAAGAAGATGATG
AGACAGAGGCAGAGCCATTATTGTTCCGTGCTGTTCCTGAGTGTCAACTATCTGGGGGGGACATTCCCAG
TGTATCAGAAGAGCAGGAATCTTCAGAGGGACAAGATTCAGGAGACATTTGCTCAGAAGAGAATCAAATA
GTTTCCTCTTATGCTTCTAAAGTCTGTTTTGAGATCGAAGAAGATTATAAAAATCGTCAGTTTCTGGGGC
CTGAAGGAAATGTGGATGTTGAGTTGATTGATAAGAGCACAAACAGATACAGCGTTTGGTTCCCCACTGC
TGGCTGGTATCTGTGGTCAGCCACAGGCCTCGGCTTCCTGGTAAGGGATGAGGTCACAGTGACGATTGCG
TTTGGTTCCTGGAGTCAGCACCTGGCCCTGGACCTGCAGCACCATGAACAGTGGCTGGTGGGCGGCCCCT
TGTTTGATGTCACTGCAGAGCCAGAGGAGGCTGTCGCCGAAATCCACCTCCCCCACTTCATCTCCCTCCA
AGCAGGTGAGGTGGACGTCTCCTGGTTTCTCGTTGCCCATTTTAAGAATGAAGGGATGGTCCTGGAGCAT
CCAGCCCGGGTGGAGCCTTTCTATGCTGTCCTGGAAAGCCCCAGCTTCTCTCTGATGGGCATCCTGCTGC
GGATCGCCAGTGGGACTCGCCTCTCCATCCCCATCACTTCCAACACATTGATCTATTATCACCCCCACCC
CGAAGATATTAAGTTCCACTTGTACCTTGTCCCCAGCGACGCCTTGCTAACAAAGGCGATAGATGATGAG
GAAGATCGCTTCCATGGTGTGCGCCTGCAGACTTCGCCCCCAATGGAACCCCTGAACTTTGGTTCCAGTT
ATATTGTGTCTAATTCTGCTAACCTGAAAGTAATGCCCAAGGAGTTGAAATTGTCCTACAGGAGCCCTGG
AGAAATTCAGCACTTCTCAAAATTCTATGCTGGGCAGATGAAGGAACCCATTCAACTTGAGATTACTGAA
AAAAGACATGGGACTTTGGTGTGGGATACTGAGGTGAAGCCAGTGGATCTCCAGCTTGTAGCTGCATCAG
CCCCTCCTCCTTTCTCAGGTGCAGCCTTTGTGAAGGAGAACCACCGGCAACTCCAAGCCAGGATGGGGGA
CCTGAAAGGGGTGCTCGATGATCTCCAAGACAATGAGGTTCTTACTGAGAATGAGAAGGAGCTGGTGGAG
CAGGAAAAGACACGGCAGAGCAAGAATGAGGCCTTGCTGAGCATGGTGGAGAAGAAAGGGGACCTGGCCC
TGGACGTGCTCTTCAGAAGCATTAGTGAAAGGGACCCTTACCTCGTGTCCTATCTTAGACAGCAGAATTT
G


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC230245 representing NM_001184900
Red=Cloning site Green=Tags(s)

MEKKECPEKSSSSEEELPRRDSGSSRNIDASKLIRLQGSRKLLVDNSIRELQYTKTGIFFQAEACVTNDT
VYRELPCVSETLCDISHFFQEDDETEAEPLLFRAVPECQLSGGDIPSVSEEQESSEGQDSGDICSEENQI
VSSYASKVCFEIEEDYKNRQFLGPEGNVDVELIDKSTNRYSVWFPTAGWYLWSATGLGFLVRDEVTVTIA
FGSWSQHLALDLQHHEQWLVGGPLFDVTAEPEEAVAEIHLPHFISLQAGEVDVSWFLVAHFKNEGMVLEH
PARVEPFYAVLESPSFSLMGILLRIASGTRLSIPITSNTLIYYHPHPEDIKFHLYLVPSDALLTKAIDDE
EDRFHGVRLQTSPPMEPLNFGSSYIVSNSANLKVMPKELKLSYRSPGEIQHFSKFYAGQMKEPIQLEITE
KRHGTLVWDTEVKPVDLQLVAASAPPPFSGAAFVKENHRQLQARMGDLKGVLDDLQDNEVLTENEKELVE
QEKTRQSKNEALLSMVEKKGDLALDVLFRSISERDPYLVSYLRQQNL

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_001184900
ORF Size 1611 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_001184900.3
RefSeq ORF 1614 bp
Locus ID 22900
UniProt ID Q9Y2G2
Cytogenetics 19q13.33
Protein Families Druggable Genome
Protein Pathways NOD-like receptor signaling pathway
MW 61.1 kDa
Gene Summary The protein encoded by this gene belongs to the caspase recruitment domain (CARD)-containing family of proteins, which are involved in pathways leading to activation of caspases or nuclear factor kappa-B (NFKB). This protein may be a component of the inflammasome, a protein complex that plays a role in the activation of proinflammatory caspases. It is thought that this protein acts as an adaptor molecule that negatively regulates NFKB activation, CASP1-dependent IL1B secretion, and apoptosis. Polymorphisms in this gene may be associated with a susceptibility to rheumatoid arthritis. Alternatively spliced transcript variants have been described for this gene. [provided by RefSeq, May 2010]
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.