SLC38A6 (NM_001172702) Human Tagged ORF Clone

CAT#: RC230220

Reviews ()
Write a review

SLC38A6 (Myc-DDK-tagged)-Human solute carrier family 38, member 6 (SLC38A6), transcript variant 1



  "NM_001172702" in other vectors (4)

Get anti-DDK tag antibody at $68 with code “DDK”. View details.

USD 494.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name SLC38A6 (NM_001172702) Human Tagged ORF Clone
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol SLC38A6
Synonyms NAT-1; SNAT6
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Cell Selection Neomycin
Sequence Data
>RC230220 representing NM_001172702
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAGGCGTCCTGGGGGAGCTTCAACGCTGAGCGGGGCTGGTATGTCTCTGTCCAGCAGCCTGAAGAAG
CGGAGGCCGAAGAGTTGAGTCCGTTGCTAAGCAACGAACTTCACAGACAGCGATCCCCAGGTGTTTCATT
TGGTTTATCAGTGTTTAATTTGATGAATGCCATCATGGGAAGTGGCATCCTTGGCTTAGCTTATGTTTTG
GCTAATACCGGTGTCTTTGGATTTAGCTTCTTGCTGCTGACAGTTGCTCTCCTGGCTTCTTACTCAGTCC
ATCTTCTGCTTAGTATGTGTATTCAGACAGCTGTAACATCTTATGAAGATCTTGGACTCTTTGCATTTGG
ATTACCTGGAAAGTTGGTGGTGGCAGGCACCATAATAATTCAGAATATTGGAGCTATGTCATCTTATCTT
TTAATTATTAAAACAGAGCTTCCTGCTGCTATTGCAGAATTTTTGACTGGAGACTATAGTAGATATTGGT
ATCTTGATGGACAAACACTACTAATAATCATATGTGTTGGCATTGTGTTCCCTCTTGCACTTCTTCCCAA
AATAGGCTTTCTTGGCTACACAAGTAGTTTATCATTTTTCTTTATGATGTTCTTTGCTCTTGTGGTAATA
ATTAAAAAATGGTCCATCCCTTGTCCTCTGACATTAAATTATGTAGAGAAAGGTTTCCAGATTTCAAATG
TTACAGATGATTGTAAGCCAAAGCTCTTTCATTTCTCCAAAGAGAGTGCTTATGCCTTACCAACCATGGC
TTTTTCATTTCTCTGCCATACCTCAATATTGCCCATATACTGTGAACTTCAAAGTCCTTCAAAGAAAAGA
ATGCAGAATGTTACCAATACAGCAATTGCTTTAAGTTTTCTCATTTATTTTATATCTGCACTCTTTGGGT
ACCTCACTTTTTATGACAAAGTGGAGTCAGAATTACTAAAAGGTTATAGTAAATACTTATCACATGATGT
TGTTGTCATGACTGTGAAGTTATGCATACTATTTGCTGTGCTTTTGACAGTCCCTCTAATCCACTTCCCT
GCCAGAAAAGCTGTAACAATGATGTTTTTCTCCAATTTTCCATTCTCATGGATTCGCCATTTTTTGATCA
CTCTAGCACTCAATATTATCATCGTTTTACTTGCAATATATGTTCCTGACATTAGAAATGTATTTGGTGT
AGTTGGTGCCAGTACATCAACATGTTTGATTTTTATATTCCCAGGACTATTTTATCTTAAACTTAGCAGA
GAGGATTTTCTGTCATGGAAAAAGCTTGGGGGTCTCATTCTGTCGCACAGGTTGGCGTGCAGTGGTGTGA
TCTCAGCTCATTGCAACCTCTGCCTCCCGGACTCAAGCAATCCTCCCACCTCAGCCTCCAGAGTAGCTGA
GACTACAGGAAGAGATACCATGGAGATGTGCACCCAGAGGAAAGGCCACGCAAGGACACAGCAAGAAGGC
AACTGTTTACAAGCCAAGGGAAGAGGCCTCAGGAGAACCAAACGTGTCCACACCTTGATCTTGCACTTCC
CAACCTCCAGAACTGTGAGCAAA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC230220 representing NM_001172702
Red=Cloning site Green=Tags(s)

MEASWGSFNAERGWYVSVQQPEEAEAEELSPLLSNELHRQRSPGVSFGLSVFNLMNAIMGSGILGLAYVL
ANTGVFGFSFLLLTVALLASYSVHLLLSMCIQTAVTSYEDLGLFAFGLPGKLVVAGTIIIQNIGAMSSYL
LIIKTELPAAIAEFLTGDYSRYWYLDGQTLLIIICVGIVFPLALLPKIGFLGYTSSLSFFFMMFFALVVI
IKKWSIPCPLTLNYVEKGFQISNVTDDCKPKLFHFSKESAYALPTMAFSFLCHTSILPIYCELQSPSKKR
MQNVTNTAIALSFLIYFISALFGYLTFYDKVESELLKGYSKYLSHDVVVMTVKLCILFAVLLTVPLIHFP
ARKAVTMMFFSNFPFSWIRHFLITLALNIIIVLLAIYVPDIRNVFGVVGASTSTCLIFIFPGLFYLKLSR
EDFLSWKKLGGLILSHRLACSGVISAHCNLCLPDSSNPPTSASRVAETTGRDTMEMCTQRKGHARTQQEG
NCLQAKGRGLRRTKRVHTLILHFPTSRTVSK

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_001172702
ORF Size 1563 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_001172702.1, NP_001166173.1
RefSeq ORF 1566 bp
Locus ID 145389
Cytogenetics 14q23.1
Protein Families Transmembrane
MW 58.4 kDa
Gene Summary Probable sodium-dependent amino acid/proton antiporter, could be a neuronal transporter for glutamate.[UniProtKB/Swiss-Prot Function]

Other Versions

Other products for "SLC38A6"
Frequently bought together (2)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 570.00


Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 150.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Molbio tools