SSH3BP1 (ABI1) (NM_001178125) Human Tagged ORF Clone

CAT#: RC229894

Reviews ()
Write a review

ABI1 (Myc-DDK-tagged)-Human abl-interactor 1 (ABI1), transcript variant 12



  "NM_001178125" in other vectors (4)

Reconstitution Protocol

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 477.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol ABI1
Synonyms ABI-1; ABLBP4; E3B1; NAP1BP; SSH3BP; SSH3BP1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC229894 representing NM_001178125
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCAGAGCTGCAGATGTTACTAGAGGAGGAGATCCCGTCTGGCAAGAGGGCGCTGATCGAGAGTTACC
AGAACCTGACTCGGGTGGCAGACTACTGTGAAAACAACTACATACAGGCTACAGACAAGAGAAAAGCTTT
AGAGGAGACCAAAGCCTATACAACCCAATCTCTAGCTAGTGTTGCTTATCAAATAAATGCATTGGCCAAC
AATGTACTCCAGTTGCTGGATATCCAAGCCTCTCAGCTTCGGAGAATGGAGTCTTCCATCAATCATATCT
CACAGCATGGAAATAACCAGCCTGCAAGAACTGGCACACTGTCGAGAACAAATCCTCCTACTCAGAAACC
GCCAAGTCCTCCCATGTCAGGCCGGGGAACACTGGGACGGAATACTCCTTATAAAACCCTGGAACCTGTT
AAACCCCCAACAGTTCCTAATGACTATATGACCAGTCCTGCTAGGCTTGGAAGTCAGCATAGTCCAGGCA
GGACAGCATCTTTAAATCAGAGACCAAGGACACACAGTGGAAGTAGTGGAGGAAGTGGAAGTCGAGAAAA
CAGTGGTAGCAGTAGTATTGGCATTCCCATTGCTGTGCCTACACCTTCGCCACCCACTATTGGACCAGTT
GCTGATAGTCCAACTCCACCGCCACCACCTCCACCAGATGACATTCCCATGTTTGATGACTCTCCACCTC
CCCCACCACCACCACCAGTGGATTATGAAGATGAGGAGGCTGCAGTAGTTCAGTATAATGATCCATATGC
AGATGGGGATCCTGCTTGGGCCCCCAAGAATTATATTGAGAAAGTTGTTGCAATATATGATTATACAAAA
GACAAGGATGATGAGCTGTCATTTATGGAGGGTGCAATCATTTATGTTATAAAGAAGAATGATGATGGCT
GGTATGAAGGAGTCTGCAATCGAGTGACTGGTCTGTTCCCTGGGAACTATGTTGAATCAATCATGCACTA
TACTGAT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC229894 representing NM_001178125
Red=Cloning site Green=Tags(s)

MAELQMLLEEEIPSGKRALIESYQNLTRVADYCENNYIQATDKRKALEETKAYTTQSLASVAYQINALAN
NVLQLLDIQASQLRRMESSINHISQHGNNQPARTGTLSRTNPPTQKPPSPPMSGRGTLGRNTPYKTLEPV
KPPTVPNDYMTSPARLGSQHSPGRTASLNQRPRTHSGSSGGSGSRENSGSSSIGIPIAVPTPSPPTIGPV
ADSPTPPPPPPPDDIPMFDDSPPPPPPPPVDYEDEEAAVVQYNDPYADGDPAWAPKNYIEKVVAIYDYTK
DKDDELSFMEGAIIYVIKKNDDGWYEGVCNRVTGLFPGNYVESIMHYTD

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_001178125
ORF Size 987 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_001178125.1, NP_001171596.1
RefSeq ORF 990 bp
Locus ID 10006
UniProt ID Q8IZP0
Cytogenetics 10p12.1
MW 36.4 kDa
Gene Summary This gene encodes a member of the Abelson-interactor family of adaptor proteins. These proteins facilitate signal transduction as components of several multiprotein complexes, and regulate actin polymerization and cytoskeletal remodeling through interactions with Abelson tyrosine kinases. The encoded protein plays a role in macropinocytosis as a component of the WAVE2 complex, and also forms a complex with EPS8 and SOS1 that mediates signal transduction from Ras to Rac. This gene may play a role in the progression of several malignancies including melanoma, colon cancer and breast cancer, and a t(10;11) chromosomal translocation involving this gene and the MLL gene has been associated with acute myeloid leukemia. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene, and a pseudogene of this gene is located on the long arm of chromosome 14. [provided by RefSeq, Sep 2011]

Other Versions

Other products for "ABI1"
Frequently bought together (5)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 165.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 627.00


Rabbit Polyclonal Anti-ABI1 Antibody
    • 100 ul

USD 380.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 149.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 55.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.