PCDH20 (NM_022843) Human Tagged ORF Clone

CAT#: RC229397

Reviews ()
Write a review

PCDH20 (Myc-DDK-tagged)-Human protocadherin 20 (PCDH20)



Reconstitution Protocol

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 851.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol PCDH20
Synonyms PCDH13
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC229397 representing NM_022843
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCGCGGCCGAGGGAATGCGCGCAGCTCACAGGCCCTGGGAGTGAGCTGGTGCCCGGCGACCTGGCACC
CGCGCCTGGATATGGGGCGTCTACATCGTCCCAGGAGCAGCACCAGCTACAGGAACCTGCCGCATCTGTT
TCTGTTTTTCCTCTTCGTGGGACCCTTCAGCTGCCTCGGGAGTTACAGCCGGGCCACCGAGCTTCTGTAC
AGCCTAAACGAGGGACTACCCGCGGGGGTGCTCATCGGCAGCCTGGCCGAGGACCTGCGGCTGCTGCCCA
GGTCTGCAGGGAGGCCGGACCCGCAGTCGCAGCTGCCAGAGCGCACCGGTGCTGAGTGGAACCCCCCTCT
CTCCTTCAGCCTGGCCTCCCGGGGACTGAGTGGCCAGTACGTGACCCTAGACAACCGCTCTGGGGAGCTG
CACACTTCAGCTCAGGAGATCGACAGGGAGGCCCTGTGTGTTGAAGGGGGTGGAGGGACTGCGTGGAGCG
GCAGCGTTTCCATCTCCTCCTCTCCTTCTGACTCTTGTCTTTTGCTGCTGGATGTGCTTGTCCTGCCTCA
GGAATACTTCAGGTTTGTGAAGGTGAAGATCGCCATCAGAGACATCAATGACAACGCCCCGCAGTTCCCT
GTTTCCCAGATCTCGGTGTGGGTCCCGGAAAATGCACCTGTAAACACCCGACTGGCCATAGAGCATCCTG
CTGTGGACCCAGATGTAGGCATTAATGGGGTACAGACCTATCGCTTACTGGACTACCATGGTATGTTCAC
CCTGGACGTGGAGGAGAATGAGAATGGGGAGCGCACCCCCTACCTAATTGTCATGGGTGCTTTGGACAGG
GAAACCCAGGACCAGTATGTGAGCATCATCATAGCTGAGGATGGTGGGTCTCCACCACTTTTGGGCAGTG
CCACTCTCACCATTGGCATCAGTGACATTAATGACAATTGCCCTCTCTTCACAGACTCACAAATCAATGT
CACTGTGTATGGGAATGCTACAGTGGGCACCCCAATTGCAGCTGTCCAGGCTGTGGATAAAGACTTGGGG
ACCAATGCTCAAATTACTTATTCTTACAGTCAGAAAGTTCCACAAGCATCTAAGGATTTATTTCACCTGG
ATGAAAACACTGGAGTCATTAAACTTTTCAGTAAGATTGGAGGAAGTGTTCTGGAGTCCCACAAGCTCAC
CATCCTTGCTAATGGACCAGGCTGCATCCCTGCTGTAATCACTGCTCTTGTGTCCATTATTAAAGTTATT
TTCAGACCCCCTGAAATTGTCCCTCGTTACATAGCAAACGAGATAGATGGTGTGGTTTATCTGAAAGAAC
TGGAACCCGTTAACACTCCCATTGCGTTTTTCACCATAAGAGATCCAGAAGGTAAATACAAGGTTAACTG
CTACCTGGATGGTGAAGGGCCGTTTAGGTTATCACCTTACAAACCATACAATAATGAATATTTACTAGAG
ACCACAAAACCTATGGACTATGAGCTACAGCAGTTCTATGAAGTAGCTGTGGTGGCTTGGAACTCTGAGG
GATTTCATGTCAAAAGGGTCATTAAAGTGCAACTTTTAGATGACAATGATAATGCTCCAATTTTCCTTCA
ACCCTTAATAGAACTAACCATCGAAGAGAACAACTCACCCAATGCCTTTTTGACTAAGCTGTATGCTACA
GATGCCGACAGCGAGGAGAGAGGCCAAGTTTCATATTTTCTGGGACCTGATGCTCCATCATATTTTTCCT
TAGACAGTGTCACAGGAATTCTGACAGTTTCTACTCAGCTGGACCGAGAAGAGAAAGAAAAGTACAGATA
CACTGTCAGAGCTGTTGACTGTGGGAAGCCACCCAGAGAATCAGTAGCCACTGTGGCCCTCACAGTGTTG
GATAAAAATGACAACAGTCCTCGGTTTATCAACAAGGACTTCAGCTTTTTTGTGCCTGAAAACTTTCCAG
GCTATGGTGAGATTGGAGTAATTAGTGTAACAGATGCTGACGCTGGACGAAATGGATGGGTCGCCCTCTC
TGTGGTGAACCAGAGTGATATTTTTGTCATAGATACAGGAAAGGGTATGCTGAGGGCTAAAGTCTCTTTG
GACAGAGAGCAGCAAAGCTCCTATACTTTGTGGGTTGAAGCTGTTGATGGGGGTGAGCCTGCCCTCTCCT
CTACAGCAAAAATCACAATTCTCCTTCTAGATATCAATGACAACCCTCCTCTTGTTTTGTTTCCTCAGTC
TAATATGTCTTATCTGTTAGTACTGCCTTCTACTCTGCCAGGCTCCCCGGTTACAGAAGTCTATGCTGTC
GACAAAGACACAGGCATGAATGCTGTCATAGCTTACAGCATCATAGGGAGAAGAGGTCCTAGGCCTGAGT
CCTTCAGGATTGACCCTAAAACTGGCAACATTACTTTGGAAGAGGCATTGCTGCAGACAGATTATGGGCT
CCATCGCTTACTGGTGAAAGTGAGTGATCATGGTTATCCCGAGCCTCTCCACTCCACAGTCATGGTGAAC
CTATTTGTCAATGACACTGTCAGTAATGAGAGTTACATTGAGAGTCTTTTAAGAAAAGAACCAGAGATTA
ATATAGAGGAGAAAGAACCACAAATCTCAATAGAACCGACTCATAGGAAGGTAGAATCTGTGTCTTGTAT
GCCCACCTTAGTAGCTCTGTCTGTAATAAGCTTGGGTTCCATCACACTGGTCACAGGGATGGGCATATAC
ATCTGTTTAAGGAAAGGGGAAAAGCATCCCAGGGAAGATGAAAATTTGGAAGTACAGATTCCACTGAAAG
GAAAAATTGACTTGCATATGCGAGAGAGAAAGCCAATGGATATTTCTAATATT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC229397 representing NM_022843
Red=Cloning site Green=Tags(s)

MRGRGNARSSQALGVSWCPATWHPRLDMGRLHRPRSSTSYRNLPHLFLFFLFVGPFSCLGSYSRATELLY
SLNEGLPAGVLIGSLAEDLRLLPRSAGRPDPQSQLPERTGAEWNPPLSFSLASRGLSGQYVTLDNRSGEL
HTSAQEIDREALCVEGGGGTAWSGSVSISSSPSDSCLLLLDVLVLPQEYFRFVKVKIAIRDINDNAPQFP
VSQISVWVPENAPVNTRLAIEHPAVDPDVGINGVQTYRLLDYHGMFTLDVEENENGERTPYLIVMGALDR
ETQDQYVSIIIAEDGGSPPLLGSATLTIGISDINDNCPLFTDSQINVTVYGNATVGTPIAAVQAVDKDLG
TNAQITYSYSQKVPQASKDLFHLDENTGVIKLFSKIGGSVLESHKLTILANGPGCIPAVITALVSIIKVI
FRPPEIVPRYIANEIDGVVYLKELEPVNTPIAFFTIRDPEGKYKVNCYLDGEGPFRLSPYKPYNNEYLLE
TTKPMDYELQQFYEVAVVAWNSEGFHVKRVIKVQLLDDNDNAPIFLQPLIELTIEENNSPNAFLTKLYAT
DADSEERGQVSYFLGPDAPSYFSLDSVTGILTVSTQLDREEKEKYRYTVRAVDCGKPPRESVATVALTVL
DKNDNSPRFINKDFSFFVPENFPGYGEIGVISVTDADAGRNGWVALSVVNQSDIFVIDTGKGMLRAKVSL
DREQQSSYTLWVEAVDGGEPALSSTAKITILLLDINDNPPLVLFPQSNMSYLLVLPSTLPGSPVTEVYAV
DKDTGMNAVIAYSIIGRRGPRPESFRIDPKTGNITLEEALLQTDYGLHRLLVKVSDHGYPEPLHSTVMVN
LFVNDTVSNESYIESLLRKEPEINIEEKEPQISIEPTHRKVESVSCMPTLVALSVISLGSITLVTGMGIY
ICLRKGEKHPREDENLEVQIPLKGKIDLHMRERKPMDISNI

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_022843
ORF Size 2853 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_022843.3, NP_073754.2
RefSeq ORF 2856 bp
Locus ID 64881
UniProt ID Q8N6Y1
Cytogenetics 13q21.2
Domains CA
Protein Families Druggable Genome, Transmembrane
MW 104.7 kDa
Gene Summary This gene belongs to the protocadherin gene family, a subfamily of the cadherin superfamily. This gene encodes a protein which contains 6 extracellular cadherin domains, a transmembrane domain and a cytoplasmic tail differing from those of the classical cadherins. Although its specific function is undetermined, the cadherin-related neuronal receptor is thought to play a role in the establishment and function of specific cell-cell connections in the brain. [provided by RefSeq, Jul 2008]
Other products for "PCDH20"
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.