GSPT1 (NM_002094) Human Tagged ORF Clone

CAT#: RC229318

Reviews ()
Write a review

GSPT1 (Myc-DDK-tagged)-Human G1 to S phase transition 1 (GSPT1), transcript variant 1



  "NM_002094" in other vectors (8)

Reconstitution Protocol

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 593.00

USD 889.00


Availability*
In Stock

Size
    • 10 ug


Product images

Other products for "GSPT1"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol GSPT1
Synonyms 551G9.2; eRF3a; ETF3A; GST1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC229318 representing NM_002094
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGATCCGGGCAGTGGCGGCGGCGGCGGCGGCGGCGGCGGCGGCGGGAGCAGCAGCGGCAGCAGCAGCA
GCGACTCGGCGCCTGACTGCTGGGACCAGGCGGACATGGAAGCCCCCGGGCCGGGCCCTTGCGGCGGCGG
CGGCTCCCTGGCGGCGGCGGCCGAGGCCCAGCGGGAGAACCTCAGCGCGGCCTTCAGCCGGCAACTCAAC
GTCAACGCCAAGCCCTTCGTGCCCAACGTCCACGCCGCCGAGTTCGTGCCGTCCTTCCTGCGGGGCCCGG
CAGCGCCGCCACCCCCAGCTGGCGGCGCCGCCAATAACCACGGAGCCGGCAGCGGCGCGGGAGGCCGTGC
GGCACCTGTGGAATCCTCTCAAGAGGAACAGTCATTGTGTGAAGGTTCAAATTCAGCTGTTAGCATGGAA
CTTTCAGAACCTATTGTAGAAAATGGAGAGACAGAAATGTCTCCAGAAGAATCATGGGAGCACAAAGAAG
AAATAAGTGAAGCAGAGCCAGGGGGTGGTTCCTTGGGAGATGGAAGGCCGCCAGAGGAAAGTGCCCATGA
AATGATGGAGGAGGAAGAGGAAATCCCAAAACCTAAGTCTGTGGTTGCACCGCCAGGTGCTCCTAAGAAA
GAGCATGTAAATGTAGTATTCATTGGGCACGTAGATGCTGGCAAGTCAACCATTGGAGGACAAATAATGT
ATTTGACTGGAATGGTTGACAAAAGGACGCTTGAAAAGTATGAAAGAGAAGCTAAAGAGAAAAACAGAGA
AACTTGGTACTTGTCTTGGGCCTTAGACACAAATCAGGAAGAACGAGACAAGGGTAAAACAGTAGAAGTG
GGTCGTGCCTATTTTGAAACCGAAAAGAAGCATTTCACAATTCTAGATGCCCCTGGCCACAAGAGTTTTG
TCCCAAATATGATTGGTGGTGCCTCTCAAGCTGATTTGGCTGTGCTGGTAATCTCAGCCAGGAAAGGAGA
GTTTGAAACTGGATTTGAAAAAGGAGGACAGACAAGAGAACATGCAATGTTGGCAAAGACAGCAGGTGTA
AAACACCTAATTGTGCTAATTAATAAGATGGATGATCCAACAGTAAATTGGAGCAATGAGAGATATGAAG
AATGTAAGGAGAAACTAGTGCCATTTTTGAAAAAAGTTGGCTTCAATCCCAAAAAGGACATTCACTTTAT
GCCCTGCTCAGGACTTACTGGAGCAAATCTCAAAGAGCAGTCGGATTTCTGTCCTTGGTACATTGGATTA
CCGTTTATTCCATATCTGGATAATTTGCCGAACTTCAATAGATCAGTTGATGGACCAATCAGGCTGCCAA
TTGTGGATAAGTACAAGGATATGGGCACTGTGGTCCTGGGAAAGCTGGAATCAGGATCTATTTGTAAAGG
CCAGCAGCTTGTGATGATGCCAAACAAGCACAACGTGGAAGTTCTTGGAATACTTTCCGATGATGTAGAG
ACTGATACCGTAGCCCCAGGTGAAAACCTCAAAATCAGACTGAAAGGAATTGAAGAAGAGGAGATTCTTC
CAGGGTTTATACTTTGTGATCCTAATAATCTTTGTCATTCTGGACGCACATTTGATGCCCAGATAGTGAT
TATAGAGCACAAATCCATCATCTGCCCAGGCTATAATGCGGTGCTGCATATTCATACCTGTATTGAGGAG
GTGGAAATAACAGCCTTAATCTGCTTGGTAGACAAAAAATCAGGAGAAAAAAGTAAGACCCGACCCCGTT
TTGTCAAACAAGATCAAGTATGCATTGCTCGCTTAAGGACAGCAGGAACCATCTGCCTTGAGACCTTTAA
AGACTTCCCTCAGATGGGTCGTTTCACCTTAAGAGATGAGGGTAAGACCATTGCAATTGGAAAAGTTCTG
AAACTGGTTCCAGAGAAAGAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC229318 representing NM_002094
Red=Cloning site Green=Tags(s)

MDPGSGGGGGGGGGGGSSSGSSSSDSAPDCWDQADMEAPGPGPCGGGGSLAAAAEAQRENLSAAFSRQLN
VNAKPFVPNVHAAEFVPSFLRGPAAPPPPAGGAANNHGAGSGAGGRAAPVESSQEEQSLCEGSNSAVSME
LSEPIVENGETEMSPEESWEHKEEISEAEPGGGSLGDGRPPEESAHEMMEEEEEIPKPKSVVAPPGAPKK
EHVNVVFIGHVDAGKSTIGGQIMYLTGMVDKRTLEKYEREAKEKNRETWYLSWALDTNQEERDKGKTVEV
GRAYFETEKKHFTILDAPGHKSFVPNMIGGASQADLAVLVISARKGEFETGFEKGGQTREHAMLAKTAGV
KHLIVLINKMDDPTVNWSNERYEECKEKLVPFLKKVGFNPKKDIHFMPCSGLTGANLKEQSDFCPWYIGL
PFIPYLDNLPNFNRSVDGPIRLPIVDKYKDMGTVVLGKLESGSICKGQQLVMMPNKHNVEVLGILSDDVE
TDTVAPGENLKIRLKGIEEEEILPGFILCDPNNLCHSGRTFDAQIVIIEHKSIICPGYNAVLHIHTCIEE
VEITALICLVDKKSGEKSKTRPRFVKQDQVCIARLRTAGTICLETFKDFPQMGRFTLRDEGKTIAIGKVL
KLVPEKD

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_002094
ORF Size 1911 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_002094.3, NP_002085.2
RefSeq ORF 1914 bp
Locus ID 2935
Cytogenetics 16p13.13
Domains GTP_EFTU, GTP_EFTU_D3, GTP_EFTU_D2
Protein Families Transmembrane
MW 68.5 kDa
Gene Summary Involved in translation termination in response to the termination codons UAA, UAG and UGA (By similarity). Stimulates the activity of ETF1 (By similarity). Involved in regulation of mammalian cell growth (PubMed:2511002). Component of the transient SURF complex which recruits UPF1 to stalled ribosomes in the context of nonsense-mediated decay (NMD) of mRNAs containing premature stop codons (PubMed:24486019).[UniProtKB/Swiss-Prot Function]

Other Versions

Frequently bought together (4)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 177.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.