GSPT1(GSPT1) (NM_002094) Human Tagged ORF Clone

CAT#: RC229318

GSPT1 (Myc-DDK-tagged)-Human G1 to S phase transition 1 (GSPT1), transcript variant 1

Clone Modification / Custom Cloning Service

USD 98.00

USD 790.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name GSPT1(GSPT1) (NM_002094) Human Tagged ORF Clone
Symbol GSPT1
Synonyms 551G9.2; eRF3a; ETF3A; GST1
Vector pCMV6-Entry
Sequence Data
>RC229318 representing NM_002094
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGATCCGGGCAGTGGCGGCGGCGGCGGCGGCGGCGGCGGCGGCGGGAGCAGCAGCGGCAGCAGCAGCA
GCGACTCGGCGCCTGACTGCTGGGACCAGGCGGACATGGAAGCCCCCGGGCCGGGCCCTTGCGGCGGCGG
CGGCTCCCTGGCGGCGGCGGCCGAGGCCCAGCGGGAGAACCTCAGCGCGGCCTTCAGCCGGCAACTCAAC
GTCAACGCCAAGCCCTTCGTGCCCAACGTCCACGCCGCCGAGTTCGTGCCGTCCTTCCTGCGGGGCCCGG
CAGCGCCGCCACCCCCAGCTGGCGGCGCCGCCAATAACCACGGAGCCGGCAGCGGCGCGGGAGGCCGTGC
GGCACCTGTGGAATCCTCTCAAGAGGAACAGTCATTGTGTGAAGGTTCAAATTCAGCTGTTAGCATGGAA
CTTTCAGAACCTATTGTAGAAAATGGAGAGACAGAAATGTCTCCAGAAGAATCATGGGAGCACAAAGAAG
AAATAAGTGAAGCAGAGCCAGGGGGTGGTTCCTTGGGAGATGGAAGGCCGCCAGAGGAAAGTGCCCATGA
AATGATGGAGGAGGAAGAGGAAATCCCAAAACCTAAGTCTGTGGTTGCACCGCCAGGTGCTCCTAAGAAA
GAGCATGTAAATGTAGTATTCATTGGGCACGTAGATGCTGGCAAGTCAACCATTGGAGGACAAATAATGT
ATTTGACTGGAATGGTTGACAAAAGGACGCTTGAAAAGTATGAAAGAGAAGCTAAAGAGAAAAACAGAGA
AACTTGGTACTTGTCTTGGGCCTTAGACACAAATCAGGAAGAACGAGACAAGGGTAAAACAGTAGAAGTG
GGTCGTGCCTATTTTGAAACCGAAAAGAAGCATTTCACAATTCTAGATGCCCCTGGCCACAAGAGTTTTG
TCCCAAATATGATTGGTGGTGCCTCTCAAGCTGATTTGGCTGTGCTGGTAATCTCAGCCAGGAAAGGAGA
GTTTGAAACTGGATTTGAAAAAGGAGGACAGACAAGAGAACATGCAATGTTGGCAAAGACAGCAGGTGTA
AAACACCTAATTGTGCTAATTAATAAGATGGATGATCCAACAGTAAATTGGAGCAATGAGAGATATGAAG
AATGTAAGGAGAAACTAGTGCCATTTTTGAAAAAAGTTGGCTTCAATCCCAAAAAGGACATTCACTTTAT
GCCCTGCTCAGGACTTACTGGAGCAAATCTCAAAGAGCAGTCGGATTTCTGTCCTTGGTACATTGGATTA
CCGTTTATTCCATATCTGGATAATTTGCCGAACTTCAATAGATCAGTTGATGGACCAATCAGGCTGCCAA
TTGTGGATAAGTACAAGGATATGGGCACTGTGGTCCTGGGAAAGCTGGAATCAGGATCTATTTGTAAAGG
CCAGCAGCTTGTGATGATGCCAAACAAGCACAACGTGGAAGTTCTTGGAATACTTTCCGATGATGTAGAG
ACTGATACCGTAGCCCCAGGTGAAAACCTCAAAATCAGACTGAAAGGAATTGAAGAAGAGGAGATTCTTC
CAGGGTTTATACTTTGTGATCCTAATAATCTTTGTCATTCTGGACGCACATTTGATGCCCAGATAGTGAT
TATAGAGCACAAATCCATCATCTGCCCAGGCTATAATGCGGTGCTGCATATTCATACCTGTATTGAGGAG
GTGGAAATAACAGCCTTAATCTGCTTGGTAGACAAAAAATCAGGAGAAAAAAGTAAGACCCGACCCCGTT
TTGTCAAACAAGATCAAGTATGCATTGCTCGCTTAAGGACAGCAGGAACCATCTGCCTTGAGACCTTTAA
AGACTTCCCTCAGATGGGTCGTTTCACCTTAAGAGATGAGGGTAAGACCATTGCAATTGGAAAAGTTCTG
AAACTGGTTCCAGAGAAAGAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC229318 representing NM_002094
Red=Cloning site Green=Tags(s)

MDPGSGGGGGGGGGGGSSSGSSSSDSAPDCWDQADMEAPGPGPCGGGGSLAAAAEAQRENLSAAFSRQLN
VNAKPFVPNVHAAEFVPSFLRGPAAPPPPAGGAANNHGAGSGAGGRAAPVESSQEEQSLCEGSNSAVSME
LSEPIVENGETEMSPEESWEHKEEISEAEPGGGSLGDGRPPEESAHEMMEEEEEIPKPKSVVAPPGAPKK
EHVNVVFIGHVDAGKSTIGGQIMYLTGMVDKRTLEKYEREAKEKNRETWYLSWALDTNQEERDKGKTVEV
GRAYFETEKKHFTILDAPGHKSFVPNMIGGASQADLAVLVISARKGEFETGFEKGGQTREHAMLAKTAGV
KHLIVLINKMDDPTVNWSNERYEECKEKLVPFLKKVGFNPKKDIHFMPCSGLTGANLKEQSDFCPWYIGL
PFIPYLDNLPNFNRSVDGPIRLPIVDKYKDMGTVVLGKLESGSICKGQQLVMMPNKHNVEVLGILSDDVE
TDTVAPGENLKIRLKGIEEEEILPGFILCDPNNLCHSGRTFDAQIVIIEHKSIICPGYNAVLHIHTCIEE
VEITALICLVDKKSGEKSKTRPRFVKQDQVCIARLRTAGTICLETFKDFPQMGRFTLRDEGKTIAIGKVL
KLVPEKD

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_002094
ORF Size 1911 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_002094.3, NP_002085
RefSeq ORF 1914
Locus ID 2935
Cytogenetics 16p13.13
Domains GTP_EFTU, GTP_EFTU_D3, GTP_EFTU_D2
Protein Families Transmembrane
MW 68.5 kDa
Gene Summary Involved in translation termination in response to the termination codons UAA, UAG and UGA. Stimulates the activity of ERF1. Involved in regulation of mammalian cell growth. Component of the transient SURF complex which recruits UPF1 to stalled ribosomes in the context of nonsense-mediated decay (NMD) of mRNAs containing premature stop codons. [UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)