PRMT6 (NM_018137) Human Tagged ORF Clone

CAT#: RC229177

Reviews ()
Write a review

PRMT6 (Myc-DDK-tagged)-Human protein arginine methyltransferase 6 (PRMT6)



  "NM_018137" in other vectors (11)

Reconstitution Protocol

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 457.00

USD 686.00


Availability*
In Stock

Size
    • 10 ug


Product images

Other products for "PRMT6"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol PRMT6
Synonyms HRMT1L6
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC229177 representing NM_018137
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCGCAGCCCAAGAAAAGAAAGCTTGAGTCGGGGGGCGGCGGCGAAGGAGGGGAGGGAACTGAAGAGG
AAGATGGCGCGGAGCGGGAGGCGGCCCTGGAGCGACCCCGGAGGACTAAGCGGGAACGGGACCAGCTGTA
CTACGAGTGCTACTCGGACGTTTCGGTCCACGAGGAGATGATCGCGGACCGCGTCCGCACCGATGCCTAC
CGCCTGGGTATCCTTCGGAACTGGGCAGCACTGCGAGGCAAGACGGTACTGGACGTGGGCGCGGGCACCG
GCATTCTGAGCATCTTCTGTGCCCAGGCCGGGGCCCGGCGCGTGTACGCGGTAGAGGCCAGCGCCATCTG
GCAACAGGCCCGGGAGGTGGTGCGGTTCAACGGGCTGGAGGACCGGGTGCACGTCCTGCCGGGACCAGTG
GAGACTGTAGAGTTGCCGGAACAGGTGGATGCCATCGTGAGCGAGTGGATGGGCTACGGACTCCTGCACG
AGTCCATGCTGAGCTCCGTCCTCCACGCGCGAACCAAGTGGCTGAAGGAGGGCGGTCTTCTCCTGCCGGC
CTCCGCCGAGCTCTTCATAGCCCCCATCAGCGACCAGATGCTGGAATGGCGCCTGGGCTTCTGGAGCCAG
GTGAAGCAGCACTATGGTGTGGACATGAGCTGCCTGGAGGGCTTCGCCACGCGCTGTCTCATGGGCCACT
CGGAGATCGTTGTGCAGGGATTGTCCGGCGAGGACGTGCTGGCCCGGCCGCAGCGCTTTGCTCAGCTAGA
GCTCTCCCGCGCCGGCTTGGAGCAGGAGCTGGAGGCCGGAGTGGGCGGGCGCTTCCGCTGCAGCTGCTAT
GGCTCGGCGCCCATGCATGGCTTTGCCATCTGGTTCCAGGTGACCTTCCCTGGAGGGGAGTCGGAGAAAC
CCCTGGTGCTGTCCACCTCGCCTTTTCACCCGGCCACTCACTGGAAACAGGCGCTCCTCTACCTGAACGA
GCCGGTGCAAGTGGAGCAAGACACGGACGTTTCAGGAGAGATCACGCTGCTGCCCTCCCGGGACAACCCC
CGTCGCCTGCGCGTGCTGCTGCGCTACAAAGTGGGAGACCAGGAGGAGAAGACCAAAGACTTTGCCATGG
AGGAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC229177 representing NM_018137
Red=Cloning site Green=Tags(s)

MSQPKKRKLESGGGGEGGEGTEEEDGAEREAALERPRRTKRERDQLYYECYSDVSVHEEMIADRVRTDAY
RLGILRNWAALRGKTVLDVGAGTGILSIFCAQAGARRVYAVEASAIWQQAREVVRFNGLEDRVHVLPGPV
ETVELPEQVDAIVSEWMGYGLLHESMLSSVLHARTKWLKEGGLLLPASAELFIAPISDQMLEWRLGFWSQ
VKQHYGVDMSCLEGFATRCLMGHSEIVVQGLSGEDVLARPQRFAQLELSRAGLEQELEAGVGGRFRCSCY
GSAPMHGFAIWFQVTFPGGESEKPLVLSTSPFHPATHWKQALLYLNEPVQVEQDTDVSGEITLLPSRDNP
RRLRVLLRYKVGDQEEKTKDFAMED

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_018137
ORF Size 1125 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_018137.3
RefSeq ORF 1128 bp
Locus ID 55170
UniProt ID Q96LA8
Cytogenetics 1p13.3
Protein Families Druggable Genome
MW 41.8 kDa
Gene Summary The protein encoded by this gene belongs to the arginine N-methyltransferase family, which catalyze the sequential transfer of methyl group from S-adenosyl-L-methionine to the side chain nitrogens of arginine residues within proteins, to form methylated arginine derivatives and S-adenosyl-L-homocysteine. This protein can catalyze both, the formation of omega-N monomethylarginine and asymmetrical dimethylarginine, with a strong preference for the latter. It specifically mediates the asymmetric dimethylation of Arg2 of histone H3, and the methylated form represents a specific tag for epigenetic transcriptional repression. This protein also forms a complex with, and methylates DNA polymerase beta, resulting in stimulation of polymerase activity by enhancing DNA binding and processivity. [provided by RefSeq, Sep 2011]

Other Versions

Frequently bought together (5)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 177.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


Mouse Monoclonal PRMT6 Antibody
    • 100 ul

USD 380.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.