C6orf134(ATAT1) (NM_024909) Human Tagged ORF Clone

CAT#: RC229162

ATAT1 (Myc-DDK-tagged)-Human alpha tubulin acetyltransferase 1 (ATAT1), transcript variant 2

Clone Modification / Custom Cloning Service

USD 423.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name C6orf134(ATAT1) (NM_024909) Human Tagged ORF Clone
Symbol ATAT1
Synonyms alpha-TAT; alpha-TAT1; C6orf134; MEC17; Nbla00487; TAT
Vector pCMV6-Entry
Sequence Data
>RC229162 representing NM_024909
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAGTTCCCGTTCGATGTGGACGCGCTGTTCCCGGAGCGGATCACGGTGCTGGACCAGCACCTGAGGC
CCCCAGCCCGCCGACCCGGAACCACAACGCCGGCCCGTGTTGATCTACAGCAGCAAATTATGACCATTAT
AGATGAACTGGGCAAGGCTTCTGCCAAGGCCCAGAATCTTTCCGCTCCTATCACTAGTGCATCAAGGATG
CAGAGTAACCGCCATGTTGTTTATATTCTCAAAGACAGTTCAGCCCGACCGGCTGGAAAAGGAGCCATTA
TTGGTTTCATCAAAGTTGGATACAAGAAGCTCTTTGTACTGGATGATCGTGAGGCTCATAATGAGGTAGA
ACCACTTTGCATCCTGGACTTTTACATCCATGAGTCTGTGCAACGCCATGGCCATGGGCGAGAACTCTTC
CAGTATATGTTGCAGAAGGAGCGAGTGGAACCGCACCAACTGGCAATTGACCGACCCTCACAGAAGCTGC
TGAAATTCCTGAATAAGCACTACAATCTGGAGACCACAGTCCCACAGGTGAACAACTTTGTGATCTTTGA
AGGCTTCTTTGCCCATCAACATCGGCCCCCTGCTCCCTCTCTGAGGGCAACTCGACACTCTCGTGCTGCT
GCAGTCGATCCCACGCCCGCTGCTCCAGCAAGGAAGCTGCCACCCAAGAGAGCAGAGGGAGACATCAAGC
CATACTCCTCTAGTGACCGAGAATTTCTGAAGGTAGCTGTGGAGCCTCCTTGGCCCCTAAACAGGGCCCC
TCGCCGCGCCACACCTCCAGCCCACCCACCCCCCCGCTCCAGCAGCCTGGGAAACTCACCAGAACGAGGT
CCCCTCCGCCCCTTTGTGCCAGAGCAGGAGCTGCTGCGTTCCTTGCGCCTCTGCCCCCCACACCCTACCG
CCCGCCTTCTGTTGGCTGCTGACCCTGGGGGCAGCCCAGCTCAACGTCGTCGCACCAGCTCCCTTCCCCG
CTCTGAGGAGAGTCGATAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC229162 representing NM_024909
Red=Cloning site Green=Tags(s)

MEFPFDVDALFPERITVLDQHLRPPARRPGTTTPARVDLQQQIMTIIDELGKASAKAQNLSAPITSASRM
QSNRHVVYILKDSSARPAGKGAIIGFIKVGYKKLFVLDDREAHNEVEPLCILDFYIHESVQRHGHGRELF
QYMLQKERVEPHQLAIDRPSQKLLKFLNKHYNLETTVPQVNNFVIFEGFFAHQHRPPAPSLRATRHSRAA
AVDPTPAAPARKLPPKRAEGDIKPYSSSDREFLKVAVEPPWPLNRAPRRATPPAHPPPRSSSLGNSPERG
PLRPFVPEQELLRSLRLCPPHPTARLLLAADPGGSPAQRRRTSSLPRSEESRY

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_024909
ORF Size 999 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_024909.2, NM_024909.3, NP_079185
RefSeq ORF 1002
Locus ID 79969
Cytogenetics 6p21.33
MW 37.9 kDa
Gene Summary This gene encodes a protein that localizes to clathrin-coated pits, where it acetylates alpha tubulin on lysine 40. This process may be important in microtubule growth, for instance during chemotaxis and the formation of cilium. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2016].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)