Neurofascin (NFASC) (NM_001005388) Human Tagged ORF Clone

CAT#: RC229070

Reviews ()
Write a review
  • TrueORF®

NFASC (Myc-DDK-tagged)-Human neurofascin (NFASC), transcript variant 1



Reconstitution Protocol

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 1,473.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol NFASC
Synonyms NEDCPMD; NF; NRCAML
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC229070 representing NM_001005388
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCCAGGCAGCCACCGCCGCCCTGGGTCCATGCAGCCTTCCTCCTCTGCCTCCTCAGTCTTGGCGGAG
CCATCGAAATTCCTATGGATCCAAGCATTCAGAATGAGCTGACGCAGCCGCCAACCATCACCAAGCAGTC
AGCGAAGGATCACATCGTGGACCCCCGTGATAACATCCTGATTGAGTGTGAAGCAAAAGGGAACCCTGCC
CCCAGCTTCCACTGGACACGAAACAGCAGATTCTTCAACATCGCCAAGGACCCCCGGGTGTCCATGAGGA
GGAGGTCTGGGACCCTGGTGATTGACTTCCGCAGTGGCGGGCGGCCGGAGGAATATGAGGGGGAATATCA
GTGCTTCGCCCGCAACAAATTTGGCACGGCCCTGTCCAATAGGATCCGCCTGCAGGTGTCTAAATCTCCT
CTGTGGCCCAAGGAAAACCTAGACCCTGTCGTGGTCCAAGAGGGCGCTCCTTTGACGCTCCAGTGCAACC
CCCCGCCTGGACTTCCATCCCCGGTCATCTTCTGGATGAGCAGCTCCATGGAGCCCATCACCCAAGACAA
ACGTGTCTCTCAGGGCCATAACGGAGACCTATACTTCTCCAACGTGATGCTGCAGGACATGCAGACCGAC
TACAGTTGTAACGCCCGCTTCCACTTCACCCACACCATCCAGCAGAAGAACCCTTTCACCCTCAAGGTCC
TCACCACCCGAGGAGTTGCAGAAAGAACACCAAGCTTCATGTATCCCCAGGGCACCGCGAGCAGCCAGAT
GGTGCTTCGTGGCATGGACCTCCTGCTGGAATGCATCGCCTCCGGGGTCCCAACACCAGACATCGCATGG
TACAAGAAAGGTGGGGACCTCCCATCTGATAAGGCCAAGTTTGAGAACTTTAATAAGGCCCTGCGTATCA
CAAATGTCTCTGAGGAAGACTCCGGGGAGTATTTCTGCCTGGCCTCCAACAAGATGGGCAGCATCCGGCA
CACGATCTCGGTGAGAGTAAAGGCTGCTCCCTACTGGCTGGACGAACCCAAGAACCTTATTCTGGCTCCT
GGCGAGGATGGGAGACTGGTGTGTCGAGCCAATGGAAACCCCAAACCCACTGTCCAGTGGATGGTGAATG
GGGAACCTTTGCAATCGGCACCACCTAACCCAAACCGTGAGGTGGCCGGAGACACCATCATCTTCCGGGA
CACCCAGATCAGCAGCAGGGCTGTGTACCAGTGCAACACCTCCAACGAGCATGGCTACCTGCTGGCCAAC
GCCTTTGTCAGTGTGCTGGATGTGCCGCCTCGGATGCTGTCGCCCCGGAACCAGCTCATTCGAGTGATTC
TTTACAACCGGACGCGGCTGGACTGCCCTTTCTTTGGGTCTCCCATCCCCACACTGCGATGGTTTAAGAA
TGGGCAAGGAAGCAACCTGGATGGTGGCAACTACCATGTTTATGAGAACGGCAGTCTGGAAATTAAGATG
ATCCGCAAAGAGGACCAGGGCATCTACACCTGTGTCGCCACCAACATCCTGGGCAAAGCTGAAAACCAAG
TCCGCCTGGAGGTCAAAGACCCCACCAGGATCTACCGGATGCCCGAGGACCAGGTGGCCAGAAGGGGCAC
CACGGTGCAGCTGGAGTGTCGGGTGAAGCACGACCCCTCCCTGAAACTCACCGTCTCCTGGCTGAAGGAT
GACGAGCCGCTCTATATTGGAAACAGGATGAAGAAGGAAGACGACTCCCTGACCATCTTTGGGGTGGCAG
AGCGGGACCAGGGCAGTTACACGTGTGTCGCCAGCACCGAGCTAGACCAAGACCTGGCCAAGGCCTACCT
CACCGTGCTAGCTGATCAGGCCACTCCAACTAACCGTTTGGCTGCCCTGCCCAAAGGACGGCCAGACCGG
CCCCGGGACCTGGAGCTGACCGACCTGGCCGAGAGGAGCGTGCGGCTGACCTGGATCCCCGGGGATGCTA
ACAACAGCCCCATCACAGACTACGTCGTCCAGTTTGAAGAAGACCAGTTCCAACCTGGGGTCTGGCATGA
CCATTCCAAGTACCCCGGCAGCGTTAACTCAGCCGTCCTCCGGCTGTCCCCGTATGTCAACTACCAGTTC
CGTGTCATTGCCATCAACGAGGTTGGGAGCAGCCACCCCAGCCTCCCATCCGAGCGCTACCGAACCAGTG
GAGCACCCCCCGAGTCCAATCCTGGTGACGTGAAGGGAGAGGGGACCAGAAAGAACAACATGGAGATCAC
GTGGACGCCCATGAATGCCACCTCGGCCTTTGGCCCCAACCTGCGCTACATTGTCAAGTGGAGGCGGAGA
GAGACTCGAGAGGCCTGGAACAACGTCACAGTGTGGGGCTCTCGCTACGTGGTGGGGCAGACCCCAGTCT
ACGTGCCCTATGAGATCCGAGTCCAGGCTGAAAATGACTTCGGGAAGGGCCCTGAGCCAGAGTCCGTCAT
CGGTTACTCCGGAGAAGATTTACCCAGTGCCCCTAGGCGTTTCCGAGTCCGGCAGCCCAACCTGGAGACA
ATCAACCTGGAATGGGATCATCCTGAGCATCCAAATGGGATCATGATTGGATACACTCTCAAATATGTGG
CCTTTAACGGGACCAAAGTAGGAAAGCAGATAGTGGAAAACTTCTCTCCCAATCAGACCAAGTTCACGGT
GCAAAGAACGGACCCCGTGTCACGCTACCGCTTTACCCTCAGCGCCAGGACGCAGGTGGGCTCTGGGGAA
GCCGTCACAGAGGAGTCACCAGCACCCCCGAATGAAGCTACTCCAACCGCAGCTCCTCCCACATTGCCCC
CGACTACCGTGGGTGCGACGGGCGCTGTGAGCAGTACCGATGCTACTGCCATTGCTGCCACCACCGAAGC
CACAACAGTCCCCATCATCCCAACTGTCGCACCTACCACCATCGCCACCACCACCACCGTCGCCACAACT
ACTACAACCACTGCTGCCGCCACCACCACCACGGAGAGTCCTCCCACCACCACCTCCGGGACTAAGATAC
ACGAATCCGCCCCTGATGAGCAGTCCATATGGAACGTCACGGTGCTCCCCAACAGTAAATGGGCCAACAT
CACCTGGAAGCACAATTTCGGGCCCGGAACTGACTTTGTGGTTGAGTACATCGACAGCAACCATACGAAA
AAAACTGTCCCAGTTAAGGCCCAGGCTCAGCCTATACAGCTGACAGACCTCTATCCCGGGATGACATACA
CGTTGCGGGTTTATTCCCGGGACAACGAGGGCATCAGCAGTACCGTCATCACCTTTATGACCAGTACAGC
TTACACCAACAACCAAGCAGACATCGCCACCCAGGGCTGGTTCATTGGGCTTATGTGCGCCATCGCCCTC
CTGGTGCTGATCCTGCTCATCGTCTGTTTCATCAAGAGGAGTCGCGGCGGCAAGTACCCAGTACGAGAAA
AGAAGGATGTTCCCCTTGGCCCTGAAGACCCCAAGGAAGAGGATGGCTCATTTGACTATAGTGATGAGGA
CAACAAGCCCCTGCAGGGCAGTCAGACATCTCTGGACGGCACCATCAAGCAGCAGGAGAGTGACGACAGC
CTGGTGGACTATGGCGAGGGTGGCGAGGGTCAGTTCAATGAAGACGGCTCCTTCATCGGCCAGTACACGG
TCAAAAAGGACAAGGAGGAAACAGAGGGCAACGAAAGCTCAGAGGCCACGTCACCTGTCAATGCTATCTA
CTCTCTGGCC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC229070 representing NM_001005388
Red=Cloning site Green=Tags(s)

MARQPPPPWVHAAFLLCLLSLGGAIEIPMDPSIQNELTQPPTITKQSAKDHIVDPRDNILIECEAKGNPA
PSFHWTRNSRFFNIAKDPRVSMRRRSGTLVIDFRSGGRPEEYEGEYQCFARNKFGTALSNRIRLQVSKSP
LWPKENLDPVVVQEGAPLTLQCNPPPGLPSPVIFWMSSSMEPITQDKRVSQGHNGDLYFSNVMLQDMQTD
YSCNARFHFTHTIQQKNPFTLKVLTTRGVAERTPSFMYPQGTASSQMVLRGMDLLLECIASGVPTPDIAW
YKKGGDLPSDKAKFENFNKALRITNVSEEDSGEYFCLASNKMGSIRHTISVRVKAAPYWLDEPKNLILAP
GEDGRLVCRANGNPKPTVQWMVNGEPLQSAPPNPNREVAGDTIIFRDTQISSRAVYQCNTSNEHGYLLAN
AFVSVLDVPPRMLSPRNQLIRVILYNRTRLDCPFFGSPIPTLRWFKNGQGSNLDGGNYHVYENGSLEIKM
IRKEDQGIYTCVATNILGKAENQVRLEVKDPTRIYRMPEDQVARRGTTVQLECRVKHDPSLKLTVSWLKD
DEPLYIGNRMKKEDDSLTIFGVAERDQGSYTCVASTELDQDLAKAYLTVLADQATPTNRLAALPKGRPDR
PRDLELTDLAERSVRLTWIPGDANNSPITDYVVQFEEDQFQPGVWHDHSKYPGSVNSAVLRLSPYVNYQF
RVIAINEVGSSHPSLPSERYRTSGAPPESNPGDVKGEGTRKNNMEITWTPMNATSAFGPNLRYIVKWRRR
ETREAWNNVTVWGSRYVVGQTPVYVPYEIRVQAENDFGKGPEPESVIGYSGEDLPSAPRRFRVRQPNLET
INLEWDHPEHPNGIMIGYTLKYVAFNGTKVGKQIVENFSPNQTKFTVQRTDPVSRYRFTLSARTQVGSGE
AVTEESPAPPNEATPTAAPPTLPPTTVGATGAVSSTDATAIAATTEATTVPIIPTVAPTTIATTTTVATT
TTTTAAATTTTESPPTTTSGTKIHESAPDEQSIWNVTVLPNSKWANITWKHNFGPGTDFVVEYIDSNHTK
KTVPVKAQAQPIQLTDLYPGMTYTLRVYSRDNEGISSTVITFMTSTAYTNNQADIATQGWFIGLMCAIAL
LVLILLIVCFIKRSRGGKYPVREKKDVPLGPEDPKEEDGSFDYSDEDNKPLQGSQTSLDGTIKQQESDDS
LVDYGEGGEGQFNEDGSFIGQYTVKKDKEETEGNESSEATSPVNAIYSLA

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_001005388
ORF Size 3720 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_001005388.2, NP_001005388.2
RefSeq Size 10351 bp
RefSeq ORF 3723 bp
Locus ID 23114
UniProt ID O94856
Cytogenetics 1q32.1
Protein Families Transmembrane
Protein Pathways Cell adhesion molecules (CAMs)
MW 138.1 kDa
Gene Summary This gene encodes an L1 family immunoglobulin cell adhesion molecule with multiple IGcam and fibronectin domains. The protein functions in neurite outgrowth, neurite fasciculation, and organization of the axon initial segment (AIS) and nodes of Ranvier on axons during early development. Both the AIS and nodes of Ranvier contain high densities of voltage-gated Na+ (Nav) channels which are clustered by interactions with cytoskeletal and scaffolding proteins including this protein, gliomedin, ankyrin 3 (ankyrin-G), and betaIV spectrin. This protein links the AIS extracellular matrix to the intracellular cytoskeleton. This gene undergoes extensive alternative splicing, and the full-length nature of some variants has not been determined.[provided by RefSeq, May 2009]
Other products for "NFASC"
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.