HIC5 (TGFB1I1) (NM_001164719) Human Tagged ORF Clone

CAT#: RC228899

Reviews ()
Write a review

TGFB1I1 (Myc-DDK-tagged)-Human transforming growth factor beta 1 induced transcript 1 (TGFB1I1), transcript variant 3



Reconstitution Protocol

USD 457.00

In Stock*

Size
    • 10 ug

Product images

Frequently bought together (4)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 177.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00

Other products for "TGFB1I1"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol TGFB1I1
Synonyms ARA55; HIC-5; HIC5; TSC-5
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC228899 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCCAAGGTCAGGGGCTCCCAAAGAGCGCCCTGCGGAGCCTCTCACCCCTCCCCCATCCTATGGCCACC
AGCCACAGACAGGGTCTGGGGAGTCTTCAGGAGCCTCGGGGGACAAGGACCACCTGTACAGCACGGTATG
CAAGCCTCGGTCCCCAAAGCCTGCAGCCCCGGCGGCCCCTCCATTCTCCTCTTCCAGCGGTGTCTTGGGT
ACCGGGCTCTGTGAGCTAGATCGGTTGCTTCAGGAACTTAATGCCACTCAGTTCAACATCACAGATGAAA
TCATGTCTCAGTTCCCATCTAGCAAGGTGGCTTCAGGAGAGCAGAAGGAGGACCAGTCTGAAGATAAGAA
AAGACCCAGCCTCCCTTCCAGCCCGTCTCCTGGCCTCCCAAAGGCTTCTGCCACCTCAGCCACTCTGGAG
CTGGATAGACTGATGGCCTCACTCTCTGACTTCCGCGTTCAAAACCATCTTCCAGCCTCTGGGCCAACTC
AGCCACCGGTGGTGAGCTCCACAAATGAGGGCTCCCCATCCCCACCAGAGCCGACTGGCAAGGGCAGCCT
AGACACCATGCTGGGGCTGCTGCAGTCCGACCTCAGCCGCCGGGGTGTTCCCACCCAGGCCAAAGGCCTC
TGTGGCTCCTGCAATAAACCTATTGCTGGGCAAGTGGTGACGGCTCTGGGCCGCGCCTGGCACCCCGAGC
ACTTCGTTTGCGGAGGCTGTTCCACCGCCCTGGGAGGCAGCAGCTTCTTCGAGAAGGATGGAGCCCCCTT
CTGCCCCGAGTGCTACTTTGAGCGCTTCTCGCCAAGATGTGGCTTCTGCAACCAGCCCATCCGACACAAG
ATGGTGACCGCCTTGGGCACTCACTGGCACCCAGAGCATTTCTGCTGCGTCAGTTGCGGGGAGCCCTTCG
GAGATGAGGGTTTCCACGAGCGCGAGGGCCGCCCCTACTGCCGCCGGGACTTCCTGCAGCTGTTCGCCCC
GCGCTGCCAGGGCTGCCAGGGCCCCATCCTGGATAACTACATCTCGGCGCTCAGCGCGCTCTGGCACCCG
GACTGTTTCGTCTGCAGGGAATGCTTCGCGCCCTTCTCGGGAGGCAGCTTTTTCGAGCACGAGGGCCGCC
CGTTGTGCGAGAACCACTTCCACGCACGACGCGGCTCGCTGTGCGCCACGTGTGGCCTCCCTGTGACCGG
CCGCTGCGTGTCGGCCCTGGGTCGCCGCTTCCACCCGGACCACTTCACATGCACCTTCTGCCTGCGCCCG
CTCACCAAGGGGTCCTTCCAGGAGCGCGCCGGCAAGCCCTACTGCCAGCCCTGCTTCCTGAAGCTCTTCG
GC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC228899 protein sequence
Red=Cloning site Green=Tags(s)

MPRSGAPKERPAEPLTPPPSYGHQPQTGSGESSGASGDKDHLYSTVCKPRSPKPAAPAAPPFSSSSGVLG
TGLCELDRLLQELNATQFNITDEIMSQFPSSKVASGEQKEDQSEDKKRPSLPSSPSPGLPKASATSATLE
LDRLMASLSDFRVQNHLPASGPTQPPVVSSTNEGSPSPPEPTGKGSLDTMLGLLQSDLSRRGVPTQAKGL
CGSCNKPIAGQVVTALGRAWHPEHFVCGGCSTALGGSSFFEKDGAPFCPECYFERFSPRCGFCNQPIRHK
MVTALGTHWHPEHFCCVSCGEPFGDEGFHEREGRPYCRRDFLQLFAPRCQGCQGPILDNYISALSALWHP
DCFVCRECFAPFSGGSFFEHEGRPLCENHFHARRGSLCATCGLPVTGRCVSALGRRFHPDHFTCTFCLRP
LTKGSFQERAGKPYCQPCFLKLFG

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_001164719
ORF Size 1332 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_001164719.1, NP_001158191.1
RefSeq Size 1782 bp
RefSeq ORF 1335 bp
Locus ID 7041
UniProt ID O43294
Cytogenetics 16p11.2
Protein Families Druggable Genome, Transcription Factors
MW 47.9 kDa
Gene Summary This gene encodes a coactivator of the androgen receptor, a transcription factor which is activated by androgen and has a key role in male sexual differentiation. The encoded protein is thought to regulate androgen receptor activity and may have a role to play in the treatment of prostate cancer. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2009]
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.