CASS4 (NM_001164116) Human Tagged ORF Clone

CAT#: RC228580

CASS4 (Myc-DDK-tagged)-Human Cas scaffolding protein family member 4 (CASS4), transcript variant 1

Clone Modification / Custom Cloning Service

USD 1,206.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name CASS4 (NM_001164116) Human Tagged ORF Clone
Symbol CASS4
Synonyms C20orf32; CAS4; HEFL; HEPL
Vector pCMV6-Entry
Sequence Data
>RC228580 representing NM_001164116
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAAGGGAACAGGCATCATGGACTGTGCGCCCAAGGCACTCCTGGCCAGGGCACTTTATGACAACTGCC
CTGACTGCTCTGACGAGCTGGCTTTCAGCAGAGGGGACATCCTGACCATTCTGGAGCAACACGTGCCAGA
AAGCGAGGGTTGGTGGAAGTGTTTGCTCCATGGGAGGCAAGGCCTGGCCCCTGCCAACCGCCTCCAAATC
CTCACGGAGGTCGCTGCAGACAGGCCGTGCCCCCCATTCCTGAGAGGCCTGGAAGAAGCTCCTGCCAGCT
CAGAGGAGACCTATCAGGTGCCCACTCTACCCCGCCCTCCCACTCCAGGCCCCGTTTATGAGCAGATGAG
GAGTTGGGCGGAGGGGCCCCAGCCCCCTACTGCCCAAGTCTATGAATTCCCCGACCCTCCCACCAGTGCC
AGAATCATCTGTGAAAAGACTCTCAGCTTTCCAAAACAGGCCATCCTCACGCTTCCCAGACCTGTCCGGG
CCTCACTGCCGACTCTGCCTTCCCAGGTGTATGACGTGCCTACCCAGCACCGGGGCCCCGTGGTCCTGAA
GGAGCCAGAGAAGCAGCAGTTATATGACATACCAGCCAGCCCCAAGAAGGCAGGACTCCATCCCCCAGAC
AGCCAAGCAAGTGGGCAGGGTGTTCCCCTGATATCAGTGACTACCTTAAGAAGAGGCGGTTACAGCACAT
TACCAAATCCTCAGAAATCGGAATGGATTTATGACACTCCAGTGTCTCCAGGAAAGGCCAGCGTCAGAAA
CACGCCTCTCACCAGCTTTGCGGAAGAATCAAGGCCCCACGCTCTCCCCAGTTCCAGCTCCACTTTCTAC
AATCCTCCAAGTGGCAGATCCAGGTCCCTCACTCCACAACTGAATAACAATGTGCCCATGCAGAAAAAAC
TCAGCCTTCCAGAAATTCCTTCTTATGGCTTTCTTGTACCCAGAGGCACATTTCCTTTGGATGAAGATGT
CAGCTACAAGGTTCCTTCAAGCTTTCTGATTCCCCGAGTGGAACAGCAGAACACCAAGCCCAATATTTAT
GACATCCCTAAAGCAACGTCGAGTGTTTCTCAGGCTGGGAAGGAGCTGGAGAAAGCCAAGGAGGTGTCAG
AGAATTCCGCGGGCCATAATTCCTCATGGTTCTCCAGACGGACAACTTCCCCATCTCCTGAACCGGACAG
ATTATCAGGTTCCAGTTCTGACAGCAGAGCTAGCATCGTTTCCTCGTGCTCCACCACATCCACCGACGAC
TCCTCCAGCTCTTCCTCGGAGGAGTCAGCAAAGGAGCTCTCCTTGGACCTGGATGTGGCCAAGGAGACAG
TGATGGCTCTGCAGCACAAGGTGGTCAGCTCTGTCGCTGGCCTGATGCTCTTTGTCAGCAGGAAGTGGAG
ATTCCGAGACTATCTGGAGGCCAACATTGATGCAATCCACAGGTCCACTGATCACATAGAAGAATCTGTA
AGAGAATTTCTGGATTTTGCCCGAGGAGTCCATGGGACTGCCTGTAACCTCACTGACAGTAACCTTCAGA
ACAGAATTCGGGACCAGATGCAGACCATCTCCAACTCCTACCGCATCCTGCTTGAAACAAAGGAAAGCTT
GGATAATCGCAATTGGCCTCTGGAAGTTCTTGTGACTGACAGTGTCCAGAACAGCCCAGATGACCTTGAG
AGGTTTGTCATGGTGGCACGGATGCTTCCAGAAGACATCAAGAGGTTTGCCTCCATTGTCATTGCCAATG
GAAGGCTCCTTTTTAAGCGGAACTGTGAAAAGGAAGAGACTGTGCAGTTGACCCCAAATGCAGAATTTAA
GTGTGAAAAATACATCCAGCCTCCCCAAAGAGAAACTGAATCACACCAAAAGAGTACCCCTTCCACTAAG
CAAAGGGAAGATGAACACTCTTCTGAACTATTAAAGAAAAATAGGGCAAATATCTGTGGACAGAATCCTG
GCCCTCTTATACCTCAGCCTTCGAGTCAACAGACTCCTGAGAGGAAACCCCGCTTATCTGAACACTGCCG
GCTCTACTTTGGGGCGCTCTTCAAAGCCATCAGCGCATTTCACGGCAGCCTCAGCAGCAGCCAGCCCGCG
GAGATCATCACTCAGAGCAAGCTGGTCATCATGGTGGGACAGAAGCTGGTGGACACGCTGTGCATGGAGA
CCCAGGAGAGGGACGTGCGCAACGAGATCCTCCGTGGCAGCAGTCACCTCTGCAGCCTGCTCAAGGACGT
AGCGCTGGCCACTAAGAATGCCGTGCTCACGTACCCCAGCCCTGCCGCGCTGGGGCACCTCCAGGCGGAG
GCTGAGAAGCTGGAGCAACACACGCGGCAGTTCAGAGGGACACTGGGA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC228580 representing NM_001164116
Red=Cloning site Green=Tags(s)

MKGTGIMDCAPKALLARALYDNCPDCSDELAFSRGDILTILEQHVPESEGWWKCLLHGRQGLAPANRLQI
LTEVAADRPCPPFLRGLEEAPASSEETYQVPTLPRPPTPGPVYEQMRSWAEGPQPPTAQVYEFPDPPTSA
RIICEKTLSFPKQAILTLPRPVRASLPTLPSQVYDVPTQHRGPVVLKEPEKQQLYDIPASPKKAGLHPPD
SQASGQGVPLISVTTLRRGGYSTLPNPQKSEWIYDTPVSPGKASVRNTPLTSFAEESRPHALPSSSSTFY
NPPSGRSRSLTPQLNNNVPMQKKLSLPEIPSYGFLVPRGTFPLDEDVSYKVPSSFLIPRVEQQNTKPNIY
DIPKATSSVSQAGKELEKAKEVSENSAGHNSSWFSRRTTSPSPEPDRLSGSSSDSRASIVSSCSTTSTDD
SSSSSSEESAKELSLDLDVAKETVMALQHKVVSSVAGLMLFVSRKWRFRDYLEANIDAIHRSTDHIEESV
REFLDFARGVHGTACNLTDSNLQNRIRDQMQTISNSYRILLETKESLDNRNWPLEVLVTDSVQNSPDDLE
RFVMVARMLPEDIKRFASIVIANGRLLFKRNCEKEETVQLTPNAEFKCEKYIQPPQRETESHQKSTPSTK
QREDEHSSELLKKNRANICGQNPGPLIPQPSSQQTPERKPRLSEHCRLYFGALFKAISAFHGSLSSSQPA
EIITQSKLVIMVGQKLVDTLCMETQERDVRNEILRGSSHLCSLLKDVALATKNAVLTYPSPAALGHLQAE
AEKLEQHTRQFRGTLG

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_001164116
ORF Size 2358 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_001164116.1, NP_001157588
RefSeq ORF 2361
Locus ID 57091
Cytogenetics 20q13.31
MW 87 kDa
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)