CHFR (NM_001161347) Human Tagged ORF Clone

CAT#: RC228465

CHFR (Myc-DDK-tagged)-Human checkpoint with forkhead and ring finger domains (CHFR), transcript variant 5

Clone Modification / Custom Cloning Service

USD 732.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name CHFR (NM_001161347) Human Tagged ORF Clone
Symbol CHFR
Synonyms RNF116; RNF196
Vector pCMV6-Entry
Sequence Data
>RC228465 representing NM_001161347
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAGCGGCCCGAGGAAGGCAAGCAGTCGCCGCCGCCGCAGCCCTGGGGACGGCTCCTGCGTCTGGGCG
CGGAGGAGGGCGAGCCGCACGTCCTCCTGAGGAAGCGGGAGTGGACCATCGGGCGGAGACGAGGTTGCGA
CCTTTCCTTCCCCAGCAATAAACTGGTCTCTGGAGATCACTGTAGAATTGTAGTGGATGAAAAATCAGGT
CAGGTGACACTGGAAGATACCAGCACCAGTGGAACAGTGATTAACAAGCTGAAGGTTGTTAAGAAGCAGA
CATGCCCTTTACAGACTGGGGATGTCATCTACTTGGTGTACAGGAAGAATGAACCGGAACACAGGTCTGG
GGGTGGTGGCATCTCCCCTAAAGGAAGTGGTCCCTCTGTGGCAAGTGATGAAGTCTCCAGCTTTGCCTCA
GCTCTCCCAGACAGAAAGACTGCGTCCTTTTCGTCGTTGGAACCCCAGGATCAGGAGGATTTGGAGCCCG
TGAAGAAGAAAATGAGAGGAGATGGGGACCTTGACCTGAACGGGCAGTTGTTGGTCGCACAACCGCGTAG
AAATGCCCAAACCGTCCACGAGGACGTCAGAGCAGCGGCTGGGAAGCCAGACAAGATGGAGGAGACGCTG
ACATGCATCATCTGCCAGGACCTGCTGCACGACTGCGTGAGTTTGCAGCCCTGCATGCACACGTTCTGCG
CGGCTTGCTACTCGGGCTGGATGGAGCGCTCGTCCCTGTGTCCTACCTGCCGCTGTCCCGTGGAGCGGAT
CTGTAAAAACCACATCCTCAACAACCTCGTGGAAGCATACCTCATCCAGCATCCAGACAAGAGTCGCAGT
GAAGAAGATGTGCAAAGTATGGATGCCAGGAATAAAATCACTCAAGACATGCTGCAGCCCAAAGTCAGGC
GGTCTTTTTCTGATGAAGAAGGGAGTTCAGAGGACCTGCTGGAGCTGTCAGACGTTGACAGTGAGTCCTC
AGACATTAGCCAGCCATACGTCGTGTGCCGGCAGTGTCCTGAGTACAGAAGGCAGGCGGCGCAGCCTCCC
CACTGCCCAGCACCCGAGGGCGAGCCAGGAGCCCCACAGGCCCTGGGGGATGCACCCTCCACGTCCGTCA
GCCTGACGACAGCAGTCCAGGATTACGTGTGCCCTCTGCAAGGAAGCCACGCCCTGTGCACCTGCTGCTT
CCAGCCCATGCCCGACCGGAGAGCGGAGCGCGAGCAGGACCCGCGTGTCGCCCCTCAGCAGTGTGCGGTC
TGCCTGCAGCCTTTCTGCCACCTGTACTGGGGCTGCACCCGGACCGGCTGCTACGGCTGCCTGGCCCCGT
TTTGTGAGCTCAACCTGGGTGACAAGTGTCTGGACGGCGTGCTGAACAACAACAGCTACGAGTCAGACAT
CCTGAAGAATTACCTGGCAACCAGAGGTTTGACATGGAAAAACATGTTGACCGAGAGCCTCGTGGCTCTC
CAGCGGGGAGTGTTTCTGCTGTCTGATTACAGAGTCACGGGAGACACCGTTCTGTGTTACTGCTGTGGCC
TGCGCAGCTTCCGTGAGCTGACCTATCAGTATCGGCAGAACATTCCTGCTTCCGAGTTGCCAGTGGCCGT
AACATCCCGTCCTGACTGCTACTGGGGCCGTAACTGCCGCACTCAGGTGAAAGCTCACCACGCCATGAAA
TTCAATCATATCTGTGAACAGACAAGGTTCAAAAAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC228465 representing NM_001161347
Red=Cloning site Green=Tags(s)

MERPEEGKQSPPPQPWGRLLRLGAEEGEPHVLLRKREWTIGRRRGCDLSFPSNKLVSGDHCRIVVDEKSG
QVTLEDTSTSGTVINKLKVVKKQTCPLQTGDVIYLVYRKNEPEHRSGGGGISPKGSGPSVASDEVSSFAS
ALPDRKTASFSSLEPQDQEDLEPVKKKMRGDGDLDLNGQLLVAQPRRNAQTVHEDVRAAAGKPDKMEETL
TCIICQDLLHDCVSLQPCMHTFCAACYSGWMERSSLCPTCRCPVERICKNHILNNLVEAYLIQHPDKSRS
EEDVQSMDARNKITQDMLQPKVRRSFSDEEGSSEDLLELSDVDSESSDISQPYVVCRQCPEYRRQAAQPP
HCPAPEGEPGAPQALGDAPSTSVSLTTAVQDYVCPLQGSHALCTCCFQPMPDRRAEREQDPRVAPQQCAV
CLQPFCHLYWGCTRTGCYGCLAPFCELNLGDKCLDGVLNNNSYESDILKNYLATRGLTWKNMLTESLVAL
QRGVFLLSDYRVTGDTVLCYCCGLRSFRELTYQYRQNIPASELPVAVTSRPDCYWGRNCRTQVKAHHAMK
FNHICEQTRFKN

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_001161347
ORF Size 1716 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_001161347.1, NP_001154819
RefSeq ORF 1719
Locus ID 55743
Cytogenetics 12q24.33
Protein Families Druggable Genome
MW 63.7 kDa
Gene Summary This gene encodes an E3 ubiquitin-protein ligase required for the maintenance of the antephase checkpoint that regulates cell cycle entry into mitosis and, therefore, may play a key role in cell cycle progression and tumorigenesis. The encoded protein has an N-terminal forkhead-associated domain, a central RING-finger domain, and a cysteine-rich C-terminal region. Alternatively spliced transcript variants that encode different protein isoforms have been described. [provided by RefSeq, Mar 2014].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)