DISC1 (NM_001164554) Human Tagged ORF Clone

CAT#: RC228304

DISC1 (Myc-DDK-tagged)-Human disrupted in schizophrenia 1 (DISC1), transcript variant q

  View "NM_001164554" in other vectors (6)

USD 98.00

USD 460.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name DISC1 (NM_001164554) Human Tagged ORF Clone
Symbol DISC1
Synonyms C1orf136; SCZD9
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Cell Selection Neomycin
Sequence Data
>RC228304 representing NM_001164554
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCCAGGCGGGGGTCCTCAGGGCGCCCCAGCCGCCGCCGGCGGCGGCGGCGTGAGCCACCGCGCAGGCA
GCCGGGATTGCTTACCACCTGCAGCGTGCTTTCGGAGGCGGCGGCTGGCACGGAGGCCGGGCTACATGAG
AAGCTCGACAGGGCCTGGGATCGGGTTCCTTTCCCCAGCAGTGGGCACACTGTTCCGGTTCCCAGGAGGG
GTGTCTGGCGAGGAGTCCCACCACTCGGAGTCCAGGGCCAGACAGTGTGGCCTTGACTCGAGAGGCCTCT
TGGTCCGGAGCCCTGTTTCCAAGAGTGCAGCAGCCCCTACTGTGACCTCTGTGAGAGGAACCTCGGCGCA
CTTTGGGATTCAGCTCAGAGGTGGCACCAGATTGCCTGACAGGCTTAGCTGGCCGTGTGGCCCTGGGAGT
GCTGGGTGGCAGCAAGAGTTTGCAGCCATGGATAGTTCTGAGACCCTGGACGCCAGCTGGGAGGCAGCCT
GCAGCGATGGAGCAAGGCGTGTCCGGGCAGCAGGCTCTCTGCCATCAGCAGAGTTGAGTAGCAACAGCTG
CAGCCCTGGCTGTGGCCCTGAGGTCCCCCCAACCCCTCCTGGCTCTCACAGTGCCTTTACCTCAAGCTTT
AGCTTTATTCGGCTCTCGCTTGGCTCTGCCGGGGAACGTGGAGAAGCAGAAGGCTGCCCACCATCCAGAG
AGGCTGAGTCCCATTGCCAGAGCCCCCAGGAGATGGGAGCCAAAGCTGCCAGCTTGGACGGGCCTCACGA
GGACCCGCGATGTCTCTCTCGGCCCTTCAGTCTCTTGGCTACACGGGTCTCTGCAGACTTGGCCCAGGCC
GCAAGGAACAGCTCCAGGCCAGAGCGTGACATGCATTCTTTACCAGACATGGACCCTGGCTCCTCCAGTT
CTCTGGATCCCTCACTGGCTGGCTGTGGTGGTGATGGGAGCAGCGGCTCAGGGGATGCCCACTCTTGGGA
CACCCTGCTCAGGAAATGGGAGCCAGTGCTGCGGGACTGCCTGCTGAGAAACCGGAGGCAGATGGAGGTA
ATATCCTTAAGATTAAAACTTCAGAAACTTCAGGAAGATGCAGTTGAGAATGATGATTATGATAAAGGTG
AGTTT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC228304 representing NM_001164554
Red=Cloning site Green=Tags(s)

MPGGGPQGAPAAAGGGGVSHRAGSRDCLPPAACFRRRRLARRPGYMRSSTGPGIGFLSPAVGTLFRFPGG
VSGEESHHSESRARQCGLDSRGLLVRSPVSKSAAAPTVTSVRGTSAHFGIQLRGGTRLPDRLSWPCGPGS
AGWQQEFAAMDSSETLDASWEAACSDGARRVRAAGSLPSAELSSNSCSPGCGPEVPPTPPGSHSAFTSSF
SFIRLSLGSAGERGEAEGCPPSREAESHCQSPQEMGAKAASLDGPHEDPRCLSRPFSLLATRVSADLAQA
ARNSSRPERDMHSLPDMDPGSSSSLDPSLAGCGGDGSSGSGDAHSWDTLLRKWEPVLRDCLLRNRRQMEV
ISLRLKLQKLQEDAVENDDYDKGEF

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_001164554
ORF Size 1125 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_001164554.1, NP_001158026
RefSeq ORF 1128
Locus ID 27185
Cytogenetics 1q42.2
MW 39.1 kDa
Gene Summary This gene encodes a protein with multiple coiled coil motifs which is located in the nucleus, cytoplasm and mitochondria. The protein is involved in neurite outgrowth and cortical development through its interaction with other proteins. This gene is disrupted in a t(1;11)(q42.1;q14.3) translocation which segregates with schizophrenia and related psychiatric disorders in a large Scottish family. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq, Jul 2008]

Other Versions

Other products for "DISC1"
Frequently bought together (3)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

USD 299.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 550.00


Rabbit Ployclonal anti-DISC1 Antibody
    • 100 ul

USD 345.00

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
40% off proteins and antibodies
68 Mouse Clones