SVH (ARMC10) (NM_001161013) Human Tagged ORF Clone

  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

SKU
RC228156
ARMC10 (Myc-DDK-tagged)-Human armadillo repeat containing 10 (ARMC10), transcript variant F
$330.00
3 Weeks*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol SVH
Synonyms PNAS-112; PNAS112; PSEC0198; SVH
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC228156 representing NM_001161013
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGTGGCCCCCGGGGCGCGGGCTGGGTGGCGGCGGGCCTGCTGCTCGGCGCGGGCGCCTGCTACTGCA
TTTACAGGCTGACCCGGGGTCGGCGGCGGGGCGACCGCGAGCTCGGGATACGCTCTTCGAAGTCCGCAGA
AGACTTAACTGATGGTTCATATGATGATGTTCTAAATGCTGAACAACTTCAGAAACTCCTTTACCTGCTG
GAGTCAACGGAGGATCCTGTAATTATTGAAAGAGCTTTGATTACTTTGGGTAACAATGCAGCCTTTTCAG
TTAACCAAGCTATTATTCGTGAATTGGGTGGTATTCCAATTGTTGCAAACAAAATCAACCATTCCAACCA
GAGTATTAAAGAGAAAGCTTTAAATGCACTAAATAACCTGAGTGTGAATGTTGAAAATCAAATCAAGATA
AAGGTGGATTCATCATTCCTTTCCCTTTATGACAGCCACGTAGCAAAGGAGATTCTTCTTCGAGTACTTA
CGCTATTTCAGAATATAAAGAACTGCCTCAAAATAGAAGGCCATTTAGCTGTGCAGCCTACTTTCACTGA
AGGTTCATTGTTTTTCCTGTTACATGGAGAAGAATGTGCCCAGAAAATAAGAGCTTTAGTTGATCACCAT
GATGCAGAGGTGAAGGAAAAGGTTGTAACAATAATACCCAAAATC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC228156 representing NM_001161013
Red=Cloning site Green=Tags(s)

MGGPRGAGWVAAGLLLGAGACYCIYRLTRGRRRGDRELGIRSSKSAEDLTDGSYDDVLNAEQLQKLLYLL
ESTEDPVIIERALITLGNNAAFSVNQAIIRELGGIPIVANKINHSNQSIKEKALNALNNLSVNVENQIKI
KVDSSFLSLYDSHVAKEILLRVLTLFQNIKNCLKIEGHLAVQPTFTEGSLFFLLHGEECAQKIRALVDHH
DAEVKEKVVTIIPKI

myc-FLAG tag
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_001161013
ORF Size 675 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001161013.2, NP_001154485.1
RefSeq Size 2297 bp
RefSeq ORF 678 bp
Locus ID 83787
UniProt ID Q8N2F6
Cytogenetics 7q22.1
Protein Families Transmembrane
MW 24.8 kDa
Summary This gene encodes a protein that contains an armadillo repeat and transmembrane domain. The encoded protein decreases the transcriptional activity of the tumor suppressor protein p53 through direct interaction with the DNA-binding domain of p53, and may play a role in cell growth and survival. Upregulation of this gene may play a role in hepatocellular carcinoma. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene, and a pseudogene of this gene is located on the long arm of chromosome 3. [provided by RefSeq, Sep 2011]
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

SKU Description Size Price
RC228156L3 Lenti-ORF clone of ARMC10 (Myc-DDK-tagged)-Human armadillo repeat containing 10 (ARMC10), transcript variant F 10 ug
$630.00
RC228156L4 Lenti-ORF clone of ARMC10 (mGFP-tagged)-Human armadillo repeat containing 10 (ARMC10), transcript variant F 10 ug
$630.00
RG228156 ARMC10 (tGFP-tagged) - Human armadillo repeat containing 10 (ARMC10), transcript variant F 10 ug
$530.00
SC326791 ARMC10 (untagged)-Human armadillo repeat containing 10 (ARMC10) transcript variant F 10 ug
$330.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.