Metabotropic Glutamate Receptor 5 (GRM5) (NM_001143831) Human Tagged ORF Clone

CAT#: RC227736

Reviews ()
Write a review

GRM5 (Myc-DDK-tagged)-Human glutamate receptor, metabotropic 5 (GRM5), transcript variant a



  "NM_001143831" in other vectors (6)

Reconstitution Protocol

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 1,144.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol GRM5
Synonyms GPRC1E; mGlu5; MGLUR5; PPP1R86
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC227736 representing NM_001143831
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGTCCTTCTGTTGATCCTGTCAGTCTTACTTTTGAAAGAAGATGTCCGTGGGAGTGCACAGTCCAGTG
AGAGGAGGGTGGTGGCTCACATGCCGGGTGACATCATTATTGGAGCTCTCTTTTCTGTTCATCACCAGCC
TACTGTGGACAAAGTTCATGAGAGGAAGTGTGGGGCGGTCCGTGAACAGTATGGCATTCAGAGAGTGGAG
GCCATGCTGCATACCCTGGAAAGGATCAATTCAGACCCCACACTCTTGCCCAACATCACACTGGGCTGTG
AGATAAGGGACTCCTGCTGGCATTCGGCTGTGGCCCTAGAGCAGAGCATTGAGTTCATAAGAGATTCCCT
CATTTCTTCAGAAGAGGAAGAAGGCTTGGTACGCTGTGTGGATGGCTCCTCCTCTTCCTTCCGCTCCAAG
AAGCCCATAGTAGGGGTCATTGGGCCTGGCTCCAGTTCTGTAGCCATTCAGGTCCAGAATTTGCTCCAGC
TTTTCAACATACCTCAGATTGCTTACTCAGCAACCAGCATGGATCTGAGTGACAAGACTCTGTTCAAATA
TTTCATGAGGGTTGTGCCTTCAGATGCTCAGCAGGCAAGGGCCATGGTGGACATAGTGAAGAGGTACAAC
TGGACCTATGTATCAGCCGTGCACACAGAAGGCAACTATGGAGAAAGTGGGATGGAAGCCTTCAAAGATA
TGTCAGCGAAGGAAGGGATTTGCATCGCCCACTCTTACAAAATCTACAGTAATGCAGGGGAGCAGAGCTT
TGATAAGCTGCTGAAGAAGCTCACAAGTCACTTGCCCAAGGCCCGGGTGGTGGCCTGCTTCTGTGAGGGC
ATGACGGTGAGAGGTCTGCTGATGGCCATGAGGCGCCTGGGTCTAGCGGGAGAATTTCTGCTTCTGGGCA
GTGATGGCTGGGCTGACAGGTATGATGTGACAGATGGATATCAGCGAGAAGCTGTTGGTGGCATCACAAT
CAAGCTCCAATCTCCCGATGTCAAGTGGTTTGATGATTATTATCTGAAGCTCCGGCCAGAAACAAACCAC
CGAAACCCTTGGTTTCAAGAATTTTGGCAGCATCGTTTTCAGTGCCGACTGGAAGGGTTTCCACAGGAGA
ACAGCAAATACAACAAGACTTGCAATAGTTCTCTGACTCTGAAAACACATCATGTTCAGGATTCCAAAAT
GGGATTTGTGATCAACGCCATCTATTCGATGGCCTATGGGCTCCACAACATGCAGATGTCCCTCTGCCCA
GGCTATGCAGGACTCTGTGATGCCATGAAGCCAATTGATGGACGGAAACTTTTGGAGTCCCTGATGAAAA
CCAATTTTACTGGGGTTTCTGGAGATACGATCCTATTCGATGAGAATGGAGACTCTCCAGGAAGGTATGA
AATAATGAATTTCAAGGAAATGGGAAAAGATTACTTTGATTATATCAACGTTGGAAGTTGGGACAATGGA
GAATTAAAAATGGATGATGATGAAGTATGGTCCAAGAAAAGCAACATCATCAGATCTGTGTGCAGTGAAC
CATGTGAGAAAGGCCAGATCAAGGTGATCCGAAAGGGAGAAGTCAGCTGTTGTTGGACCTGTACACCTTG
TAAGGAGAATGAGTATGTCTTTGATGAGTACACATGCAAGGCATGCCAACTGGGGTCTTGGCCCACTGAT
GATCTCACAGGTTGTGACTTGATCCCAGTACAGTATCTTCGATGGGGTGACCCTGAACCCATTGCAGCTG
TGGTGTTTGCCTGCCTTGGCCTCCTGGCCACCCTGTTTGTTACTGTAGTCTTCATCATTTACCGTGATAC
ACCAGTAGTCAAGTCCTCAAGCAGGGAACTCTGCTACATTATCCTTGCTGGCATCTGCCTGGGCTACTTA
TGTACCTTCTGCCTCATTGCGAAGCCCAAACAGATTTACTGCTACCTTCAGAGAATTGGCATTGGTCTCT
CCCCAGCCATGAGCTACTCAGCCCTTGTAACAAAGACCAACCGTATTGCAAGGATCCTGGCTGGCAGCAA
GAAGAAGATCTGTACCAAAAAGCCCAGATTCATGAGTGCCTGTGCCCAGCTAGTGATTGCTTTCATTCTC
ATATGCATCCAGTTGGGCATCATCGTTGCCCTCTTTATAATGGAGCCTCCTGACATAATGCATGACTACC
CAAGCATTCGAGAAGTCTACCTGATCTGTAACACCACCAACCTAGGAGTTGTCACTCCACTTGGATACAA
TGGATTGTTGATTTTGAGCTGCACCTTCTATGCGTTCAAGACCAGAAATGTTCCAGCTAACTTCAACGAG
GCCAAGTATATCGCCTTCACAATGTACACGACCTGCATTATATGGCTAGCTTTTGTGCCAATCTACTTTG
GCAGCAACTACAAAATCATCACCATGTGTTTCTCGGTCAGCCTCAGTGCCACAGTGGCCCTAGGCTGCAT
GTTTGTGCCGAAGGTGTACATCATCCTGGCCAAACCAGAGAGAAACGTGCGCAGCGCCTTCACCACATCT
ACCGTGGTGCGCATGCATGTAGGGGATGGCAAGTCATCCTCCGCAGCCAGCAGATCCAGCAGCCTAGTCA
ACCTGTGGAAGAGAAGGGGCTCCTCTGGGGAAACCTTAAGGTACAAAGACAGGAGACTGGCCCAGCACAA
GTCGGAAATAGAGTGTTTCACCCCCAAAGGGAGTATGGGGAATGGTGGGAGAGCAACAATGAGCAGTTCC
AATGGAAAATCCGTCACGTGGGCCCAGAATGAGAAGAGCAGCCGGGGGCAGCACCTGTGGCAGCGCCTGT
CCATCCACATCAACAAGAAAGAAAACCCCAACCAAACGGCCGTCATCAAGCCCTTCCCCAAGAGCACGGA
GAGCCGTGGCCTGGGCGCTGGCGCTGGCGCAGGCGGGAGCGCTGGGGGCGTGGGGGCCACGGGCGGTGCG
GGCTGCGCAGGCGCCGGCCCAGGCGGGCCCGAGTCCCCAGACGCCGGCCCCAAGGCGCTGTATGATGTGG
CCGAGGCTGAGGAGCACTTCCCGGCGCCCGCGCGGCCGCGCTCACCGTCGCCCATCAGCACGCTGAGCCA
CCGCGCGGGCTCGGCCAGCCGCACGGACGACGATGTGCCGTCGCTGCACTCGGAGCCTGTGGCGCGCAGC
AGCTCCTCGCAGGGCTCCCTCATGGAGCAGATCAGCAGTGTGGTCACCCGCTTCACGGCCAACATCAGCG
AGCTCAACTCCATGATGCTGTCCACCGCGGCCCCCAGCCCCGGCGTCGGCGCCCCGCTCTGCTCGTCCTA
CCTGATCCCCAAAGAGATCCAGTTGCCCACGACCATGACGACCTTTGCCGAAATCCAGCCTCTGCCGGCC
ATCGAAGTCACGGGCGGCGCGCAGCCCGCGGCAGGGGCGCAGGCGGCTGGGGACGCGGCCCGGGAGAGCC
CCGCGGCCGGTCCCGAGGCTGCGGCCGCCAAGCCAGACCTGGAGGAGCTGGTGGCTCTCACCCCGCCGTC
CCCCTTCAGAGACTCGGTGGACTCGGGGAGCACAACCCCCAACTCGCCAGTGTCCGAGTCGGCCCTCTGT
ATCCCGTCGTCTCCCAAATATGACACTCTTATCATAAGAGATTACACTCAGAGCTCCTCGTCGTTG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC227736 representing NM_001143831
Red=Cloning site Green=Tags(s)

MVLLLILSVLLLKEDVRGSAQSSERRVVAHMPGDIIIGALFSVHHQPTVDKVHERKCGAVREQYGIQRVE
AMLHTLERINSDPTLLPNITLGCEIRDSCWHSAVALEQSIEFIRDSLISSEEEEGLVRCVDGSSSSFRSK
KPIVGVIGPGSSSVAIQVQNLLQLFNIPQIAYSATSMDLSDKTLFKYFMRVVPSDAQQARAMVDIVKRYN
WTYVSAVHTEGNYGESGMEAFKDMSAKEGICIAHSYKIYSNAGEQSFDKLLKKLTSHLPKARVVACFCEG
MTVRGLLMAMRRLGLAGEFLLLGSDGWADRYDVTDGYQREAVGGITIKLQSPDVKWFDDYYLKLRPETNH
RNPWFQEFWQHRFQCRLEGFPQENSKYNKTCNSSLTLKTHHVQDSKMGFVINAIYSMAYGLHNMQMSLCP
GYAGLCDAMKPIDGRKLLESLMKTNFTGVSGDTILFDENGDSPGRYEIMNFKEMGKDYFDYINVGSWDNG
ELKMDDDEVWSKKSNIIRSVCSEPCEKGQIKVIRKGEVSCCWTCTPCKENEYVFDEYTCKACQLGSWPTD
DLTGCDLIPVQYLRWGDPEPIAAVVFACLGLLATLFVTVVFIIYRDTPVVKSSSRELCYIILAGICLGYL
CTFCLIAKPKQIYCYLQRIGIGLSPAMSYSALVTKTNRIARILAGSKKKICTKKPRFMSACAQLVIAFIL
ICIQLGIIVALFIMEPPDIMHDYPSIREVYLICNTTNLGVVTPLGYNGLLILSCTFYAFKTRNVPANFNE
AKYIAFTMYTTCIIWLAFVPIYFGSNYKIITMCFSVSLSATVALGCMFVPKVYIILAKPERNVRSAFTTS
TVVRMHVGDGKSSSAASRSSSLVNLWKRRGSSGETLRYKDRRLAQHKSEIECFTPKGSMGNGGRATMSSS
NGKSVTWAQNEKSSRGQHLWQRLSIHINKKENPNQTAVIKPFPKSTESRGLGAGAGAGGSAGGVGATGGA
GCAGAGPGGPESPDAGPKALYDVAEAEEHFPAPARPRSPSPISTLSHRAGSASRTDDDVPSLHSEPVARS
SSSQGSLMEQISSVVTRFTANISELNSMMLSTAAPSPGVGAPLCSSYLIPKEIQLPTTMTTFAEIQPLPA
IEVTGGAQPAAGAQAAGDAARESPAAGPEAAAAKPDLEELVALTPPSPFRDSVDSGSTTPNSPVSESALC
IPSSPKYDTLIIRDYTQSSSSL

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_001143831
ORF Size 3636 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_001143831.3
RefSeq ORF 3639 bp
Locus ID 2915
UniProt ID P41594
Cytogenetics 11q14.2-q14.3
Protein Families Druggable Genome, GPCR, Transmembrane
Protein Pathways Calcium signaling pathway, Gap junction, Huntington's disease, Long-term depression, Long-term potentiation, Neuroactive ligand-receptor interaction
MW 132.47 kDa
Gene Summary This gene encodes a member of the G-protein coupled receptor 3 protein family. The encoded protein is a metabatropic glutamate receptor, whose signaling activates a phosphatidylinositol-calcium second messenger system. This protein may be involved in the regulation of neural network activity and synaptic plasticity. Glutamatergic neurotransmission is involved in most aspects of normal brain function and can be perturbed in many neuropathologic conditions. A pseudogene of this gene has been defined on chromosome 11. Alternative splicing results in multiple transcript variants. [provided by RefSeq, May 2014]

Other Versions

Other products for "GRM5"
Frequently bought together (5)
GRM5 rabbit polyclonal antibody
    • 100 ul

USD 380.00


Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 165.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 627.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 149.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 55.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.