Caspase 5 (CASP5) (NM_001136109) Human Tagged ORF Clone

CAT#: RC227593

Reviews ()
Write a review

CASP5 (Myc-DDK-tagged)-Human caspase 5, apoptosis-related cysteine peptidase (CASP5), transcript variant b

  View "NM_001136109" in other vectors (6)

USD 410.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name Caspase 5 (CASP5) (NM_001136109) Human Tagged ORF Clone
Symbol CASP5
Synonyms ICE(rel)III; ICEREL-III; ICH-3
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Cell Selection Neomycin
Sequence Data
>RC227593 representing NM_001136109
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCTGAAGACAACCACAAAAAAAAAACAGTTAAGATGTTGGAATACCTGGGCAAAGATGTTCTTCATG
GTGTTTTTAATTATTTGGCAAAACACGATGTTCTGACATTGAAGGAAGAGGAAAAGAAAAAATATTATGA
TACCAAAATTGAAGACAAGGCCCTGATCTTGGTAGACTCTTTGCGAAAGAATCGCGTGGCTCATCAAATG
TTTACCCAAACACTTCTCAATATGGACCAAAAGATCACCAGTGTAAAACCTCTTCTGCAAATCGAGGCTG
GACCACCTGAGTCAGCAGAATCTACAAATATACTCAAACTTTGTCCTCGTGAAGAATTCCTGAGACTGTG
TAAAAAAAATCATGATGAGATCTATCCAATAAAAAAGAGAGAGGACCGCAGACGCCTGGCTCTCATCATA
TGCAATACAAAGTTTGATCACCTGCCTGCAAGGAATGGGGCTCACTATGACATCGTGGGGATGAAAAGGC
TGCTTCAAGGCCTGGGCTACACTGTGGTTGACGAAAAGAATCTCACAGCCAGGGATATGGAGTCAGTGCT
GAGGGCATTTGCTGCCAGACCAGAGCACAAGTCCTCTGACAGCACGTTCTTGGTACTCATGTCTCATGGC
ATCCTAGAGGGAATCTGCGGAACTGCGCATAAAAAGAAAAAACCGGATGTGCTGCTTTATGACACCATCT
TCCAGATATTCAACAACCGCAACTGCCTCAGTCTAAAGGACAAACCCAAGGTCATCATTGTCCAGGCCTG
CAGAGGTGAAAAACATGGGGAACTCTGGGTCAGAGACTCTCCAGCATCCTTGGCACTCATCTCTTCACAG
TCATCTGAGAACCTGGAGGCAGATTCTGTTTGCAAGATCCACGAGGAGAAGGACTTCATTGCTTTCTGTT
CTTCAACACCACATAACGTGTCCTGGAGAGACCGCACAAGGGGCTCCATCTTCATTACGGAACTCATCAC
ATGCTTCCAGAAATATTCTTGCTGCTGCCACCTAATGGAAATATTTCGGAAGGTACAGAAATCATTTGAA
GTTCCACAGGCTAAAGCCCAGATGCCCACCATAGAACGAGCAACCTTGACAAGAGATTTCTACCTCTTTC
CTGGCAAT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC227593 representing NM_001136109
Red=Cloning site Green=Tags(s)

MAEDNHKKKTVKMLEYLGKDVLHGVFNYLAKHDVLTLKEEEKKKYYDTKIEDKALILVDSLRKNRVAHQM
FTQTLLNMDQKITSVKPLLQIEAGPPESAESTNILKLCPREEFLRLCKKNHDEIYPIKKREDRRRLALII
CNTKFDHLPARNGAHYDIVGMKRLLQGLGYTVVDEKNLTARDMESVLRAFAARPEHKSSDSTFLVLMSHG
ILEGICGTAHKKKKPDVLLYDTIFQIFNNRNCLSLKDKPKVIIVQACRGEKHGELWVRDSPASLALISSQ
SSENLEADSVCKIHEEKDFIAFCSSTPHNVSWRDRTRGSIFITELITCFQKYSCCCHLMEIFRKVQKSFE
VPQAKAQMPTIERATLTRDFYLFPGN

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_001136109
ORF Size 1128 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_001136109.1, NP_001129581
RefSeq ORF 1131
Locus ID 838
Cytogenetics 11q22.3
Protein Families Druggable Genome, Protease
Protein Pathways NOD-like receptor signaling pathway
MW 43.1 kDa
Gene Summary This gene encodes a member of the cysteine-aspartic acid protease (caspase) family. Sequential activation of caspases plays a central role in the execution-phase of cell apoptosis. Caspases exist as inactive proenzymes which undergo proteolytic processing at conserved aspartic residues to produce two subunits, large and small, that dimerize to form the active enzyme. Overexpression of the active form of this enzyme induces apoptosis in fibroblasts. Max, a central component of the Myc/Max/Mad transcription regulation network important for cell growth, differentiation, and apoptosis, is cleaved by this protein; this process requires Fas-mediated dephosphorylation of Max. The expression of this gene is regulated by interferon-gamma and lipopolysaccharide. Alternatively spliced transcript variants have been identified for this gene. [provided by RefSeq, Aug 2010]

Other Versions

Other products for "CASP5"
Frequently bought together (3)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

USD 299.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 550.00


Rabbit polyclonal CASP5 (p10, Cleaved-Ser331) antibody
    • 100 ul

USD 335.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
40% off proteins and antibodies
68 Mouse Clones