CD51 (ITGAV) (NM_001144999) Human Tagged ORF Clone

CAT#: RC227470

Reviews ()
Write a review

ITGAV (Myc-DDK-tagged)-Human integrin, alpha V (vitronectin receptor, alpha polypeptide, antigen CD51) (ITGAV), transcript variant 2



  "NM_001144999" in other vectors (6)

Get anti-DDK tag antibody at $68 with code “DDK”. View details.

USD 1,191.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name CD51 (ITGAV) (NM_001144999) Human Tagged ORF Clone
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol ITGAV
Synonyms CD51; MSK8; VNRA; VTNR
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Cell Selection Neomycin
Sequence Data
>RC227470 representing NM_001144999
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCTCCTAGGCACCCTCCTTCTGATCCTGTACATCTTAATGTTGTGCCGGATGTTTCTTCTCGTGGGAG
CTCCCAAAGCAAACACCACCCAGCCTGGGATTGTGGAAGGAGGGCAGGTCCTCAAATGTGACTGGTCTTC
TACCCGCCGGTGCCAGCCAATTGAATTTGATGCAACAGGCAATAGAGATTATGCCAAGGATGATCCATTG
GAATTTAAGTCCCATCAGTGGTTTGGAGCATCTGTGAGGTCGAAACAGGATAAAATTTTGGCCTGTGCCC
CATTGTACCATTGGAGAACTGAGATGAAACAGGAGCGAGAGCCTGTTGGAACATGCTTTCTTCAAGATGG
AACAAAGACTGTTGAGTATGCTCCATGTAGATCACAAGATATTGATGCTGATGGACAGGGATTTTGTCAA
GGAGGATTCAGCATTGATTTTACTAAAGCTGACAGAGTACTTCTTGGTGGTCCTGGTAGCTTTTATTGGC
AAGGTCAGCTTATTTCGGATCAAGTGGCAGAAATCGTATCTAAATACGACCCCAATGTTTACAGCATCAA
GTATAATAACCAATTAGCAACTCGGACTGCACAAGCTATTTTTGATGACAGCTATTTGGGTTATTCTGTG
GCTGTCGGAGATTTCAATGGTGATGGCATAGATGACTTTGTTTCAGGAGTTCCAAGAGCAGCAAGGACTT
TGGGAATGGTTTATATTTATGATGGGAAGAACATGTCCTCCTTATACAATTTTACTGGCGAGCAGATGGC
TGCATATTTCGGATTTTCTGTAGCTGCCACTGACATTAATGGAGATGATTATGCAGATGTGTTTATTGGA
GCACCTCTCTTCATGGATCGTGGCTCTGATGGCAAACTCCAAGAGGTGGGGCAGGTCTCAGTGTCTCTAC
AGAGAGCTTCAGGAGACTTCCAGACGACAAAGCTGAATGGATTTGAGGTCTTTGCACGGTTTGGCAGTGC
CATAGCTCCTTTGGGAGATCTGGACCAGGATGGTTTCAATGATATTGCAATTGCTGCTCCATATGGGGGT
GAAGATAAAAAAGGAATTGTTTATATCTTCAATGGAAGATCAACAGGCTTGAACGCAGTCCCATCTCAAA
TCCTTGAAGGGCAGTGGGCTGCTCGAAGCATGCCACCAAGCTTTGGCTATTCAATGAAAGGAGCCACAGA
TATAGACAAAAATGGATATCCAGACTTAATTGTAGGAGCTTTTGGTGTAGATCGAGCTATCTTATACAGG
GCCAGACCAGTTATCACTGTAAATGCTGGTCTTGAAGTGTACCCTAGCATTTTAAATCAAGACAATAAAA
CCTGCTCACTGCCTGGAACAGCTCTCAAAGTTTCCTGTTTTAATGTTAGGTTCTGCTTAAAGGCAGATGG
CAAAGGAGTACTTCCCAGGAAACTTAATTTCCAGGTGGAACTTCTTTTGGATAAACTCAAGCAAAAGGGA
GCAATTCGACGAGCACTGTTTCTCTACAGCAGGTCCCCAAGTCACTCCAAGAACATGACTATTTCAAGGG
GGGGACTGATGCAGTGTGAGGAATTGATAGCGTATCTGCGGGATGAATCTGAATTTAGAGACAAACTCAC
TCCAATTACTATTTTTATGGAATATCGGTTGGATTATAGAACAGCTGCTGATACAACAGGCTTGCAACCC
ATTCTTAACCAGTTCACGCCTGCTAACATTAGTCGACAGGCTCACATTCTACTTGACTGTGGTGAAGACA
ATGTCTGTAAACCCAAGCTGGAAGTTTCTGTAGATAGTGATCAAAAGAAGATCTATATTGGGGATGACAA
CCCTCTGACATTGATTGTTAAGGCTCAGAATCAAGGAGAAGGTGCCTACGAAGCTGAGCTCATCGTTTCC
ATTCCACTGCAGGCTGATTTCATCGGGGTTGTCCGAAACAATGAAGCCTTAGCAAGACTTTCCTGTGCAT
TTAAGACAGAAAACCAAACTCGCCAGGTGGTATGTGACCTTGGAAACCCAATGAAGGCTGGAACTCAACT
CTTAGCTGGTCTTCGTTTCAGTGTGCACCAGCAGTCAGAGATGGATACTTCTGTGAAATTTGACTTACAA
ATCCAAAGCTCAAATCTATTTGACAAAGTAAGCCCAGTTGTATCTCACAAAGTTGATCTTGCTGTTTTAG
CTGCAGTTGAGATAAGAGGAGTCTCGAGTCCTGATCATATCTTTCTTCCGATTCCAAACTGGGAGCACAA
GGAGAACCCTGAGACTGAAGAAGATGTTGGGCCAGTTGTTCAGCACATCTATGAGCTGAGAAACAATGGT
CCAAGTTCATTCAGCAAGGCAATGCTCCATCTTCAGTGGCCTTACAAATATAATAATAACACTCTGTTGT
ATATCCTTCATTATGATATTGATGGACCAATGAACTGCACTTCAGATATGGAGATCAACCCTTTGAGAAT
TAAGATCTCATCTTTGCAAACAACTGAAAAGAATGACACGGTTGCCGGGCAAGGTGAGCGGGACCATCTC
ATCACTAAGCGGGATCTTGCCCTCAGTGAAGGAGATATTCACACTTTGGGTTGTGGAGTTGCTCAGTGCT
TGAAGATTGTCTGCCAAGTTGGGAGATTAGACAGAGGAAAGAGTGCAATCTTGTACGTAAAGTCATTACT
GTGGACTGAGACTTTTATGAATAAAGAAAATCAGAATCATTCCTATTCTCTGAAGTCGTCTGCTTCATTT
AATGTCATAGAGTTTCCTTATAAGAATCTTCCAATTGAGGATATCACCAACTCCACATTGGTTACCACTA
ATGTCACCTGGGGCATTCAGCCAGCGCCCATGCCTGTGCCTGTGTGGGTGATCATTTTAGCAGTTCTAGC
AGGATTGTTGCTACTGGCTGTTTTGGTATTTGTAATGTACAGGATGGGCTTTTTTAAACGGGTCCGGCCA
CCTCAAGAAGAACAAGAAAGGGAGCAGCTTCAACCTCATGAAAATGGTGAAGGAAACTCAGAAACT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC227470 representing NM_001144999
Red=Cloning site Green=Tags(s)

MLLGTLLLILYILMLCRMFLLVGAPKANTTQPGIVEGGQVLKCDWSSTRRCQPIEFDATGNRDYAKDDPL
EFKSHQWFGASVRSKQDKILACAPLYHWRTEMKQEREPVGTCFLQDGTKTVEYAPCRSQDIDADGQGFCQ
GGFSIDFTKADRVLLGGPGSFYWQGQLISDQVAEIVSKYDPNVYSIKYNNQLATRTAQAIFDDSYLGYSV
AVGDFNGDGIDDFVSGVPRAARTLGMVYIYDGKNMSSLYNFTGEQMAAYFGFSVAATDINGDDYADVFIG
APLFMDRGSDGKLQEVGQVSVSLQRASGDFQTTKLNGFEVFARFGSAIAPLGDLDQDGFNDIAIAAPYGG
EDKKGIVYIFNGRSTGLNAVPSQILEGQWAARSMPPSFGYSMKGATDIDKNGYPDLIVGAFGVDRAILYR
ARPVITVNAGLEVYPSILNQDNKTCSLPGTALKVSCFNVRFCLKADGKGVLPRKLNFQVELLLDKLKQKG
AIRRALFLYSRSPSHSKNMTISRGGLMQCEELIAYLRDESEFRDKLTPITIFMEYRLDYRTAADTTGLQP
ILNQFTPANISRQAHILLDCGEDNVCKPKLEVSVDSDQKKIYIGDDNPLTLIVKAQNQGEGAYEAELIVS
IPLQADFIGVVRNNEALARLSCAFKTENQTRQVVCDLGNPMKAGTQLLAGLRFSVHQQSEMDTSVKFDLQ
IQSSNLFDKVSPVVSHKVDLAVLAAVEIRGVSSPDHIFLPIPNWEHKENPETEEDVGPVVQHIYELRNNG
PSSFSKAMLHLQWPYKYNNNTLLYILHYDIDGPMNCTSDMEINPLRIKISSLQTTEKNDTVAGQGERDHL
ITKRDLALSEGDIHTLGCGVAQCLKIVCQVGRLDRGKSAILYVKSLLWTETFMNKENQNHSYSLKSSASF
NVIEFPYKNLPIEDITNSTLVTTNVTWGIQPAPMPVPVWVIILAVLAGLLLLAVLVFVMYRMGFFKRVRP
PQEEQEREQLQPHENGEGNSET

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_001144999
ORF Size 3006 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_001144999.2, NP_001138471.1
RefSeq ORF 3009 bp
Locus ID 3685
UniProt ID P06756
Cytogenetics 2q32.1
Protein Families Druggable Genome, ES Cell Differentiation/IPS, Transmembrane
Protein Pathways Arrhythmogenic right ventricular cardiomyopathy (ARVC), Cell adhesion molecules (CAMs), Dilated cardiomyopathy, ECM-receptor interaction, Focal adhesion, Hypertrophic cardiomyopathy (HCM), Pathways in cancer, Regulation of actin cytoskeleton, Small cell lung cancer
MW 111 kDa
Gene Summary The product of this gene belongs to the integrin alpha chain family. Integrins are heterodimeric integral membrane proteins composed of an alpha subunit and a beta subunit that function in cell surface adhesion and signaling. The encoded preproprotein is proteolytically processed to generate light and heavy chains that comprise the alpha V subunit. This subunit associates with beta 1, beta 3, beta 5, beta 6 and beta 8 subunits. The heterodimer consisting of alpha V and beta 3 subunits is also known as the vitronectin receptor. This integrin may regulate angiogenesis and cancer progression. Alternative splicing results in multiple transcript variants. Note that the integrin alpha 5 and integrin alpha V subunits are encoded by distinct genes. [provided by RefSeq, Oct 2015]

Other Versions

Other products for "ITGAV"
Frequently bought together (4)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 165.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 627.00


Rabbit Monoclonal antibody against CD51 / Integrin alpha-V (ITGAV)
    • 100 ul

USD 568.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 149.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Molbio tools