FAM178A(SLF2) (NM_001136123) Human Tagged ORF Clone

CAT#: RC227146

FAM178A (Myc-DDK-tagged)-Human family with sequence similarity 178, member A (FAM178A), transcript variant 2

Change vector?

  • TrueORF®

USD 1,813


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name FAM178A(SLF2) (NM_001136123) Human Tagged ORF Clone
Symbol SLF2
Synonyms C10orf6; FAM178A
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC227146 representing NM_001136123
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGACAAGGCGCTGCATGCCCGCTAGGCCAGGTTTCCCCTCATCCCCAGCCCCGGGGTCGTCGCCCCCGC
GCTGCCATCTGAGACCCGGTAGTACCGCCCATGCTGCAGCGGGAAAGAGAACAGAGAGTCCTGGGGACAG
GAAGCAGTCAATTATAGATTTCTTCAAACCAGCTTCAAAACAAGACAGACACATGTTGGATTCACCACAA
AAATCAAACATCAAATATGGAGGAAGTAGATTGTCTATCACTGGGACAGAGCAGTTTGAAAGGAAACTAT
CCTCACCAAAAGAATCTAAACCCAAAAGGGTGCCACCAGAAAAGAGCCCTATTATAGAAGCTTTCATGAA
AGGTGTTAAAGAGCACCATGAAGATCATGGTATACATGAGTCACGTCGGCCTTGTCTGTCACTAGCCTCC
AAATATTTAGCCAAAGGAACAAATATCTATGTTCCTTCTTCATATCACTTGCCAAAGGAGATGAAGTCAC
TAAAGAAAAAACATCGATCCCCAGAGAGAAGGAAGTCACTATTCATTCATGAAAATAATGAGAAGAATGA
TAGAGATCGAGGCAAAACCAATGCAGACTCCAAAAAGCAGACCACAGTGGCAGAAGCTGACATCTTCAAT
AACAGCTCCAGAAGCCTTAGCAGCAGGAGCAGCCTGTCCAGGCACCACCCGGAAGAAAGCCCACTGGGAG
CTAAATTCCAGTTGTCACTAGCTTCTTACTGCAGAGAACGAGAACTAAAGAGGTTGAGAAAGGAGCAAAT
GGAGCAGAGAATCAACTCCGAGAATTCTTTCTCAGAAGCAAGCAGTCTTTCCTTAAAATCTAGTATAGAA
AGAAAATATAAACCAAGGCAGGAACAAAGGAAACAGAATGACATCATACCTGGAAAAAATAATCTGTCAA
ATGTGGAAAATGGACATCTCTCAAGAAAAAGATCCTCTTCTGATTCATGGGAACCTACTTCAGCAGGCTC
TAAGCAGAATAAATTCCCTGAAAAAAGAAAAAGGAACTCTGTGGACTCAGATCTGAAAAGCACAAGAGAA
TCTATGATACCAAAAGCAAGAGAGTCCTTCCTTGAGAAGCGTCCTGATGGACCACATCAGAAAGAAAAAT
TTATAAAACATATTGCACTGAAGACACCTGGTGATGTGTTGCGCTTAGAAGATATATCCAAGGAACCGAG
TGATGAAACTGATGGCTCTTCTGCAGGCTTGGCACCTTCAAATTCTGGCAATTCTGGCCACCATTCTACC
AGGAATAGTGACCAAATCCAAGTGGCAGGTACCAAGGAGACTAAGATGCAGAAACCCCACTTACCTTTAT
CTCAGGAAAAGTCTGCAATTAAAAAAGCTAGCAACCTTCAGAAAAATAAAACCGCTAGCTCCACGACAAA
GGAGAAGGAGACAAAACTACCTTTACTTTCCCGTGTTCCAAGTGCTGGTTCCTCTCTAGTACCATTAAAT
GCTAAAAATTGTGCTCTTCCAGTTTCTAAAAAAGATAAAGAGCGTTCCTCATCTAAAGAATGTTCTGGGC
ATTCTACAGAATCCACCAAACACAAGGAACACAAAGCAAAGACTAATAAGGCCGATTCTAATGTATCTTC
AGGGAAAATTTCTGGGGGACCTTTGCGCTCAGAATATGGCACTCCTACAAAGTCTCCCCCTGCTGCTTTG
GAAGTTGTGCCATGTATCCCAAGCCCTGCAGCACCTTCAGATAAAGCCCCTTCAGAAGGAGAGAGTTCAG
GAAATTCCAATGCAGGTAGCAGTGCACTGAAAAGAAAACTAAGGGGTGATTTTGATAGTGATGAAGAAAG
TTTAGGTTACAACCTAGACAGTGATGAGGAAGAGGAAACATTAAAGTCACTGGAAGAAATAATGGCTTTG
AACTTCAATCAGACTCCTGCAGCTACAGGAAAGCCTCCTGCTCTTTCCAAGGGGCTTAGATCTCAGTCAT
CAGACTATACAGGACATGTTCATCCTGGAACTTACACAAATACCTTAGAACGTCTAGTGAAGGAAATGGA
AGACACACAAAGGCTAGATGAACTGCAGAAGCAACTACAAGAAGACATAAGGCAAGGCCGAGGCATTAAA
TCCCCAATCAGAATTGGAGAAGAAGACAGTACAGATGATGAGGATGGCCTCTTAGAAGAGCACAAGGAAT
TTCTAAAGAAATTTTCAGTTACAATTGATGCTATTCCTGATCATCATCCAGGTGAAGAAATATTTAATTT
CCTCAATTCTGGAAAAATTTTCAATCAGTATACCTTGGATTTAAGAGACTCTGGTTTTATTGGACAAAGT
GCTGTAGAAAAACTTATTCTTAAATCGGGAAAAACAGATCAGATTTTTTTGACAACACAAGGTTTCCTTA
CGTCTGCTTATCACTATGTCCAGTGTCCTGTCCCTGTGTTAAAGTGGCTGTTTCGGATGATGTCAGTTCA
TACAGACTGTATTGTGTCAGTGCAGATTTTAAGTACATTGATGGAAATAACAATTAGAAATGATACCTTC
AGTGACTCACCAGTTTGGCCATGGATCCCATCATTGTCTGATGTAGCAGCTGTGTTTTTCAATATGGGGA
TTGATTTTAGATCTTTGTTTCCCCTGGAGAATCTTCAGCCAGACTTTAATGAAGACTATCTAGTTTCTGA
AACACAGACAACATCAAGGGGGAAAGAAAGTGAAGATTCATCTTATAAGCCAATTTTTTCAACACTTCCT
GAAACCAACATTTTAAATGTGGTTAAGTTTCTAGGCTTGTGTACATCTATACATCCAGAAGGTTACCAGG
ATCGTGAAATAATGTTGCTGATTTTAATGTTATTTAAAATGAGTTTGGAAAAACAGCTGAAACAGATTCC
TTTAGTAGACTTTCAAAGCCTCCTGATAAACCTGATGAAAAACATCAGAGATTGGAACACAAAGGTGCCT
GAACTCTGTCTGGGCATAAATGAACTCTCCAGTCATCCCCACAACCTCCTGTGGTTGGTACAGCTGGTCC
CTAATTGGACATCACGTGGAAGGCAACTGAGACAGTGCCTCAGTCTAGTGATTATTTCAAAGCTTTTGGA
TGAGAAACACGAAGATGTTCCTAATGCCAGTAATCTGCAGGTATCAGTCCTACATCGCTATCTTGTGCAG
ATGAAGCCTTCTGATTTGTTAAAGAAAATGGTCTTGAAGAAAAAGGCTGAACAACCAGATGGCATTATTG
ATGACAGTCTTCATTTAGAACTTGAAAAGCAGGCATATTACCTGACCTACATTCTTCTTCATTTAGTCGG
TGAAGTTAGTTGTTCTCATTCTTTTTCTTCTGGACAACGGAAACACTTTGTGCTACTCTGTGGGGCTTTG
GAAAAGCATGTTAAATGTGATATTAGGGAAGATGCAAGACTTTTTTACAGAACTAAGGTGAAAGACTTGG
TCGCCAGGATACATGGAAAATGGCAGGAAATAATCCAGAACTGTCGGCCTACTCAGGTGTCATTTTGTTA
TACAATTTCATGTATTCTTAATAGTTTTGCTGAATGGCACTCTTCATACTGTTTGAAA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC227146 representing NM_001136123
Red=Cloning site Green=Tags(s)

MTRRCMPARPGFPSSPAPGSSPPRCHLRPGSTAHAAAGKRTESPGDRKQSIIDFFKPASKQDRHMLDSPQ
KSNIKYGGSRLSITGTEQFERKLSSPKESKPKRVPPEKSPIIEAFMKGVKEHHEDHGIHESRRPCLSLAS
KYLAKGTNIYVPSSYHLPKEMKSLKKKHRSPERRKSLFIHENNEKNDRDRGKTNADSKKQTTVAEADIFN
NSSRSLSSRSSLSRHHPEESPLGAKFQLSLASYCRERELKRLRKEQMEQRINSENSFSEASSLSLKSSIE
RKYKPRQEQRKQNDIIPGKNNLSNVENGHLSRKRSSSDSWEPTSAGSKQNKFPEKRKRNSVDSDLKSTRE
SMIPKARESFLEKRPDGPHQKEKFIKHIALKTPGDVLRLEDISKEPSDETDGSSAGLAPSNSGNSGHHST
RNSDQIQVAGTKETKMQKPHLPLSQEKSAIKKASNLQKNKTASSTTKEKETKLPLLSRVPSAGSSLVPLN
AKNCALPVSKKDKERSSSKECSGHSTESTKHKEHKAKTNKADSNVSSGKISGGPLRSEYGTPTKSPPAAL
EVVPCIPSPAAPSDKAPSEGESSGNSNAGSSALKRKLRGDFDSDEESLGYNLDSDEEEETLKSLEEIMAL
NFNQTPAATGKPPALSKGLRSQSSDYTGHVHPGTYTNTLERLVKEMEDTQRLDELQKQLQEDIRQGRGIK
SPIRIGEEDSTDDEDGLLEEHKEFLKKFSVTIDAIPDHHPGEEIFNFLNSGKIFNQYTLDLRDSGFIGQS
AVEKLILKSGKTDQIFLTTQGFLTSAYHYVQCPVPVLKWLFRMMSVHTDCIVSVQILSTLMEITIRNDTF
SDSPVWPWIPSLSDVAAVFFNMGIDFRSLFPLENLQPDFNEDYLVSETQTTSRGKESEDSSYKPIFSTLP
ETNILNVVKFLGLCTSIHPEGYQDREIMLLILMLFKMSLEKQLKQIPLVDFQSLLINLMKNIRDWNTKVP
ELCLGINELSSHPHNLLWLVQLVPNWTSRGRQLRQCLSLVIISKLLDEKHEDVPNASNLQVSVLHRYLVQ
MKPSDLLKKMVLKKKAEQPDGIIDDSLHLELEKQAYYLTYILLHLVGEVSCSHSFSSGQRKHFVLLCGAL
EKHVKCDIREDARLFYRTKVKDLVARIHGKWQEIIQNCRPTQVSFCYTISCILNSFAEWHSSYCLK

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_001136123
ORF Size 3558 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_001136123.1, NP_001129595
RefSeq ORF 3561
Locus ID 55719
Cytogenetics 10q24.31
MW 133.2 kDa
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations