Girdin(CCDC88A) (NM_001135597) Human Tagged ORF Clone

CAT#: RC226549

CCDC88A (Myc-DDK-tagged)-Human coiled-coil domain containing 88A (CCDC88A), transcript variant 1

Change vector?

  • TrueORF®

USD 1,999


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name Girdin(CCDC88A) (NM_001135597) Human Tagged ORF Clone
Symbol CCDC88A
Synonyms APE; GIRDIN; GIV; GRDN; HkRP1; KIAA1212; PEHO
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC226549 representing NM_001135597
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAGAACGAAATTTTTACTCCCCTTCTGGAGCAGTTCATGACCAGCCCTTTGGTCACTTGGGTTAAAA
CGTTTGGACCTCTGGCCGCAGGAAATGGGACCAACCTTGATGAATATGTGGCTTTGGTGGATGGGGTATT
CTTGAACCAGGTCATGCTCCAAATTAATCCTAAATTGGAGAGTCAGAGAGTAAATAAAAAAGTCAATAAT
GATGCCTCACTTAGAATGCACAATCTATCCATTTTGGTGAGACAGATAAAATTTTATTACCAGGAGACTT
TGCAGCAATTGATCATGATGTCGTTGCCAAATGTCTTAATCATTGGCAAAAATCCCTTTTCTGAACAAGG
CACAGAAGAAGTTAAAAAACTGCTTTTACTTTTATTGGGTTGTGCAGTTCAGTGTCAGAAAAAAGAGGAA
TTTATTGAAAGAATTCAAGGTTTAGATTTTGATACAAAAGCAGCGGTTGCCGCACATATTCAAGAGGTAA
CTCATAATCAGGAAAATGTGTTTGACCTGCAATGGATGGAAGTGACTGATATGTCGCAGGAGGACATAGA
ACCACTCTTGAAAAATATGGCATTGCATCTAAAAAGACTTATAGATGAGAGAGATGAACATTCAGAGACT
ATCATAGAACTCTCTGAAGAGCGGGATGGTCTCCATTTTCTACCCCATGCCTCTTCATCTGCACAGTCAC
CCTGTGGTTCTCCAGGCATGAAGCGAACAGAAAGTCGACAACATCTGTCGGTGGAACTGGCAGATGCTAA
AGCCAAGATAAGAAGGCTTAGGCAGGAATTGGAGGAAAAGACTGAGCAGTTGTTGGATTGTAAACAAGAA
CTTGAGCAAATGGAAATAGAACTCAAAAGGCTGCAACAAGAGAACATGAATTTGCTTTCGGATGCTCGCT
CTGCCAGAATGTACCGAGATGAATTAGATGCACTTCGAGAGAAAGCAGTCAGAGTCGATAAGCTTGAAAG
TGAAGTCAGCAGATATAAAGAGAGACTACATGATATTGAATTTTATAAGGCAAGAGTTGAGGAATTAAAA
GAAGACAATCAAGTTTTATTAGAAACAAAAACCATGTTGGAAGACCAACTAGAGGGAACTCGTGCTCGTT
CTGATAAATTACATGAATTAGAAAAAGAGAACTTACAACTGAAAGCTAAACTTCATGATATGGAAATGGA
ACGAGATATGGATAGAAAAAAGATTGAAGAATTAATGGAAGAAAATATGACTTTGGAAATGGCACAGAAA
CAAAGTATGGATGAATCATTACATCTTGGCTGGGAACTGGAACAGATATCCAGAACTAGTGAACTTTCCG
AAGCACCCCAGAAATCCCTGGGCCATGAGGTGAATGAGTTGACATCAAGTAGATTATTGAAGCTAGAGAT
GGAAAATCAAAGTTTGACAAAAACCGTAGAAGAGCTTCGGACTACTGTGGATTCTGTAGAAGGCAATGCT
TCCAAAATCCTGAAAATGGAAAAAGAAAATCAAAGGCTCAGTAAAAAGGTTGAGATTCTTGAAAATGAGA
TTGTTCAAGAAAAGCAAAGTCTTCAGAATTGTCAGAATTTAAGCAAGGATCTAATGAAGGAGAAAGCTCA
GCTTGAAAAAACAATAGAAACACTGAGAGAAAATTCAGAGAGACAGATTAAGATACTGGAACAGGAAAAT
GAACATCTGAATCAAACAGTGTCTTCCTTAAGGCAGCGGTCCCAGATAAGTGCAGAAGCAAGAGTGAAAG
ACATTGAAAAAGAAAACAAAATTCTTCATGAATCTATCAAAGAAACAAGTAGCAAGCTAAGCAAGATTGA
ATTTGAAAAAAGACAAATTAAAAAAGAATTGGAACATTATAAAGAAAAAGGAGAACGAGCTGAAGAACTT
GAAAATGAATTGCATCATCTTGAAAAAGAAAATGAATTATTACAGAAAAAAATAACTAATTTAAAAATTA
CTTGTGAAAAAATTGAGGCCTTAGAACAAGAAAATTCAGAGCTAGAAAGAGAAAATAGAAAATTAAAAAA
AACATTGGATAGCTTTAAAAATCTGACCTTTCAGTTAGAATCCCTAGAAAAAGAGAATTCCCAACTTGAT
GAGGAAAACTTAGAACTGCGAAGGAATGTAGAATCTTTGAAGTGTGCAAGCATGAAAATGGCTCAGCTAC
AGCTAGAAAACAAAGAACTGGAAAGTGAAAAAGAGCAACTTAAGAAGGGTTTGGAGCTCCTGAAAGCATC
TTTCAAGAAAACAGAACGCTTAGAAGTTAGCTACCAGGGTTTAGATATAGAAAATCAAAGACTGCAAAAA
ACTTTAGAGAACAGCAATAAAAAAATCCAGCAATTAGAGAGTGAACTACAAGACTTAGAGATGGAAAATC
AAACATTGCAGAAAAACCTAGAAGAACTAAAAATATCTAGCAAAAGACTAGAACAGCTGGAAAAAGAAAA
TAAATCATTAGAGCAAGAGACTTCTCAACTGGAAAAGGATAAGAAACAATTGGAGAAGGAAAATAAGAGA
CTCCGACAACAAGCAGAAATTAAAGATACCACATTAGAAGAAAATAATGTGAAGATTGGAAATTTGGAAA
AAGAAAACAAAACCCTATCCAAAGAAATTGGTATATATAAAGAATCTTGTGTCCGTCTGAAAGAACTAGA
AAAAGAAAATAAGGAGCTTGTGAAAAGAGCAACTATTGATATAAAAACGTTGGTTACACTACGTGAGGAT
TTGGTGAGTGAAAAGTTGAAGACCCAACAGATGAACAATGATCTCGAAAAATTAACTCATGAGCTTGAGA
AGATAGGGTTAAATAAGGAGCGACTCTTACATGATGAACAAAGTACTGATGACAGGTATAAACTTTTGGA
ATCAAAATTAGAATCCACTCTTAAGAAGTCTCTTGAAATAAAAGAAGAAAAAATTGCTGCTTTAGAAGCT
CGATTAGAAGAATCCACGAATTATAACCAGCAATTGCGCCAAGAACTTAAAACAGTGAAAAAAAATTATG
AAGCTCTCAAACAGAGACAAGATGAGGAAAGGATGGTACAGAGCTCTCCTCCAATATCTGGTGAAGACAA
CAAATGGGAGCGAGAAAGTCAAGAAACGACTAGAGAACTTCTGAAAGTTAAAGACAGATTAATTGAAGTA
GAAAGAAATAATGCTACACTGCAAGCAGAGAAGCAAGCGTTGAAAACTCAACTGAAGCAACTTGAGACAC
AGAACAATAATTTGCAGGCTCAGATTCTTGCACTTCAGAGGCAGACAGTGTCATTACAAGAACAGAATAC
CACTCTTCAAACACAGAATGCCAAGCTTCAGGTTGAAAATTCCACCCTTAATTCCCAAAGTACCTCACTC
ATGAACCAGAATGCCCAACTCCTAATCCAGCAGTCTTCCTTAGAAAATGAAAATGAATCTGTAATCAAAG
AGCGAGAAGACCTAAAATCTCTCTATGATTCTCTGATCAAAGATCATGAAAAGCTGGAACTTCTTCATGA
ACGTCAGGCTTCAGAGTATGAATCTCTTATCTCTAAACATGGAACTCTGAAGTCTGCCCACAAAAATCTT
GAGGTGGAACATAGAGACCTTGAAGACCGTTACAATCAGTTATTAAAACAGAAAGGACAGTTGGAAGATT
TGGAAAAAATGCTCAAAGTAGAACAGGAAAAAATGCTGCTTGAAAATAAAAATCATGAAACAGTAGCTGC
AGAATACAAGAAACTTTGTGGTGAAAATGATAGGCTGAATCATACCTATAGTCAACTTTTAAAAGAGACT
GAAGTTTTACAAACTGACCATAAAAATTTGAAAAGTCTTCTGAATAATTCCAAACTGGAACAAACAAGAT
TAGAAGCTGAATTTTCAAAACTAAAGGAACAATACCAACAATTGGATATTACATCAACCAAGCTGAATAA
CCAGTGTGAGTTGCTAAGCCAACTTAAAGGAAATTTAGAAGAAGAAAATCGGCATCTACTAGATCAAATT
CAGACATTAATGCTACAGAACAGAACACTTTTGGAGCAGAATATGGAAAGCAAGGATCTTTTTCATGTTG
AACAAAGACAGTACATTGATAAGTTAAATGAATTAAGACGTCAGAAGGAGAAACTAGAAGAGAAAATTAT
GGATCAATACAAATTTTATGACCCATCTCCTCCTAGAAGGAGAGGCAACTGGATTACTCTAAAAATGAGA
AAATTGATAAAGTCTAAGAAAGATATTAATCGGGAACGCCAGAAATCTCTAACATTAACACCCACCCGCT
CAGACTCCAGTGAAGGATTTCTTCAGCTCCCTCATCAAGACAGTCAAGATAGTTCTTCAGTAGGTTCAAA
CTCTTTAGAAGATGGCCAGACCTTGGGGACCAAGAAAAGCAGCATGGTTGCACTGAAAAGACTGCCCTTT
TTGAGGAACAGACCGAAGGATAAAGACAAAATGAAGGCCTGCTACCGTCGTTCCATGTCCATGAATGACC
TGGTGCAGTCCATGGTCCTAGCAGGACAGTGGACAGGTAGTACTGAGAATTTGGAGGTTCCTGATGATAT
TTCAACGGGTAAAAGGAGAAAAGAATTGGGAGCTATGGCCTTCTCTACTACAGCCATCAACTTTTCAACT
GTCAACTCTTCTGCAGGCTTCAGATCCAAGCAGTTGGTTAATAATAAAGATACTACATCCTTTGAAGACA
TAAGTCCACAAGGTGTTAGTGATGATTCTAGTACGGGATCAAGAGTTCATGCTTCAAGACCAGCCAGCCT
TGATAGTGGCAGAACATCCACTAGCAATAGCAATAATAATGCTTCACTACATGAAGTCAAAGCAGGTGCA
GTTAATAACCAAAGCAGGCCACAAAGCCACAGCAGTGGAGAATTTAGCCTGCTTCATGACCATGAGGCTT
GGTCCAGCAGTGGTAGCAGTCCAATCCAGTACTTGAAAAGACAGACCAGATCAAGCCCAGTGCTCCAGCA
CAAAATATCTGAAACACTGGAGAGTCGACATCACAAGATCAAAACTGGTTCCCCTGGAAGTGAAGTTGTT
ACTCTACAACAGTTTTTGGAAGAAAGCAATAAGCTTACCTCAGTACAGATAAAGTCCTCAAGTCAAGAGA
ATCTTTTAGATGAAGTAATGAAAAGTTTGTCTGTCTCTTCTGACTTTTTGGGAAAAGACAAACCAGTTAG
CTGTGGTCTGGCCAGGTCAGTAAGTGGAAAAACCCCAGGGGACTTCTATGATAGACGGACAACTAAGCCT
GAGTTTTTGAGACCTGGTCCTCGAAAAACTGAAGATACCTACTTCATTAGTTCTGCGGGAAAACCTACAC
CAGGCACTCAAGGAAAAATAAAATTAGTAAAAGAATCTTCTCTGTCACGACAATCAAAAGATAGTAACCC
TTATGCAACTTTACCTCGTGCAAGCAGCGTGATCTCAACTGCCGAAGGAACTACACGAAGGACAAGCATC
CATGATTTTTTGACCAAGGACAGTAGACTGCCTATATCAGTTGATTCACCACCAGCTGCTGCTGACAGCA
ACACCACTGCAGCATCTAATGTGGACAAAGTACAAGAAAGCAGAAATTCAAAAAGCAGGTCTAGGGAGCA
ACAAAGCTCC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC226549 representing NM_001135597
Red=Cloning site Green=Tags(s)

MENEIFTPLLEQFMTSPLVTWVKTFGPLAAGNGTNLDEYVALVDGVFLNQVMLQINPKLESQRVNKKVNN
DASLRMHNLSILVRQIKFYYQETLQQLIMMSLPNVLIIGKNPFSEQGTEEVKKLLLLLLGCAVQCQKKEE
FIERIQGLDFDTKAAVAAHIQEVTHNQENVFDLQWMEVTDMSQEDIEPLLKNMALHLKRLIDERDEHSET
IIELSEERDGLHFLPHASSSAQSPCGSPGMKRTESRQHLSVELADAKAKIRRLRQELEEKTEQLLDCKQE
LEQMEIELKRLQQENMNLLSDARSARMYRDELDALREKAVRVDKLESEVSRYKERLHDIEFYKARVEELK
EDNQVLLETKTMLEDQLEGTRARSDKLHELEKENLQLKAKLHDMEMERDMDRKKIEELMEENMTLEMAQK
QSMDESLHLGWELEQISRTSELSEAPQKSLGHEVNELTSSRLLKLEMENQSLTKTVEELRTTVDSVEGNA
SKILKMEKENQRLSKKVEILENEIVQEKQSLQNCQNLSKDLMKEKAQLEKTIETLRENSERQIKILEQEN
EHLNQTVSSLRQRSQISAEARVKDIEKENKILHESIKETSSKLSKIEFEKRQIKKELEHYKEKGERAEEL
ENELHHLEKENELLQKKITNLKITCEKIEALEQENSELERENRKLKKTLDSFKNLTFQLESLEKENSQLD
EENLELRRNVESLKCASMKMAQLQLENKELESEKEQLKKGLELLKASFKKTERLEVSYQGLDIENQRLQK
TLENSNKKIQQLESELQDLEMENQTLQKNLEELKISSKRLEQLEKENKSLEQETSQLEKDKKQLEKENKR
LRQQAEIKDTTLEENNVKIGNLEKENKTLSKEIGIYKESCVRLKELEKENKELVKRATIDIKTLVTLRED
LVSEKLKTQQMNNDLEKLTHELEKIGLNKERLLHDEQSTDDRYKLLESKLESTLKKSLEIKEEKIAALEA
RLEESTNYNQQLRQELKTVKKNYEALKQRQDEERMVQSSPPISGEDNKWERESQETTRELLKVKDRLIEV
ERNNATLQAEKQALKTQLKQLETQNNNLQAQILALQRQTVSLQEQNTTLQTQNAKLQVENSTLNSQSTSL
MNQNAQLLIQQSSLENENESVIKEREDLKSLYDSLIKDHEKLELLHERQASEYESLISKHGTLKSAHKNL
EVEHRDLEDRYNQLLKQKGQLEDLEKMLKVEQEKMLLENKNHETVAAEYKKLCGENDRLNHTYSQLLKET
EVLQTDHKNLKSLLNNSKLEQTRLEAEFSKLKEQYQQLDITSTKLNNQCELLSQLKGNLEEENRHLLDQI
QTLMLQNRTLLEQNMESKDLFHVEQRQYIDKLNELRRQKEKLEEKIMDQYKFYDPSPPRRRGNWITLKMR
KLIKSKKDINRERQKSLTLTPTRSDSSEGFLQLPHQDSQDSSSVGSNSLEDGQTLGTKKSSMVALKRLPF
LRNRPKDKDKMKACYRRSMSMNDLVQSMVLAGQWTGSTENLEVPDDISTGKRRKELGAMAFSTTAINFST
VNSSAGFRSKQLVNNKDTTSFEDISPQGVSDDSSTGSRVHASRPASLDSGRTSTSNSNNNASLHEVKAGA
VNNQSRPQSHSSGEFSLLHDHEAWSSSGSSPIQYLKRQTRSSPVLQHKISETLESRHHKIKTGSPGSEVV
TLQQFLEESNKLTSVQIKSSSQENLLDEVMKSLSVSSDFLGKDKPVSCGLARSVSGKTPGDFYDRRTTKP
EFLRPGPRKTEDTYFISSAGKPTPGTQGKIKLVKESSLSRQSKDSNPYATLPRASSVISTAEGTTRRTSI
HDFLTKDSRLPISVDSPPAAADSNTTAASNVDKVQESRNSKSRSREQQSS

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_001135597
ORF Size 5610 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_001135597.1, NP_001129069
RefSeq ORF 5613
Locus ID 55704
Cytogenetics 2p16.1
MW 215.8 kDa
Gene Summary This gene encodes a member of the Girdin family of coiled-coil domain containing proteins. The encoded protein is an actin-binding protein that is activated by the serine/threonine kinase Akt and plays a role in cytoskeleton remodeling and cell migration. The encoded protein also enhances Akt signaling by mediating phosphoinositide 3-kinase (PI3K)-dependent activation of Akt by growth factor receptor tyrosine kinases and G protein-coupled receptors. Increased expression of this gene and phosphorylation of the encoded protein may play a role in cancer metastasis. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Dec 2011].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations