Plexin A4 (PLXNA4) (NM_020911) Human Tagged ORF Clone

CAT#: RC226436

Reviews ()
Write a review

PLXNA4 (Myc-DDK-tagged)-Human plexin A4 (PLXNA4), transcript variant 1



Reconstitution Protocol

USD 1,591.00

In Stock*

Size
    • 10 ug

Product images

Frequently bought together (4)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 177.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00

Other products for "PLXNA4"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol PLXNA4
Synonyms FAYV2820; PLEXA4; PLXNA4A; PLXNA4B; PRO34003
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC226436 representing NM_020911
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAAAGCCATGCCCTGGAACTGGACCTGCCTTCTCTCCCACCTCCTCATGGTGGGCATGGGCTCCTCCA
CTTTGCTCACCCGGCAGCCAGCCCCGCTGTCCCAGAAGCAGCGGTCATTTGTCACATTCCGAGGAGAGCC
CGCCGAGGGTTTCAATCACCTGGTGGTGGATGAGAGGACAGGACACATTTACTTGGGGGCCGTCAATCGG
ATTTACAAGCTCTCCAGCGACCTGAAGGTCTTGGTGACGCATGAGACAGGGCCGGACGAGGACAACCCCA
AGTGTTACCCACCCCGCATCGTCCAGACCTGCAATGAGCCCCTGACCACCACCAACAATGTCAACAAGAT
GCTCCTCATAGACTACAAGGAGAACAGGCTGATTGCCTGTGGGAGCCTGTACCAAGGCATCTGCAAGCTG
CTGAGGCTGGAGGACCTCTTCAAGCTGGGGGAGCCTTATCATAAGAAGGAGCACTATCTGTCAGGTGTCA
ACGAGAGCGGCTCAGTCTTTGGAGTGATCGTCTCCTACAGCAACCTGGATGACAAGCTGTTCATTGCCAC
GGCAGTGGATGGGAAGCCCGAGTATTTTCCCACCATCTCCAGCCGGAAACTGACCAAGAACTCTGAGGCG
GATGGCATGTTCGCGTACGTCTTCCATGATGAGTTCGTGGCCTCGATGATTAAGATCCCTTCGGACACCT
TCACCATCATCCCTGACTTTGATATCTACTATGTCTATGGTTTTAGCAGTGGCAACTTTGTCTACTTTTT
GACCCTCCAACCTGAGATGGTGTCTCCACCAGGCTCCACCACCAAGGAGCAGGTGTATACATCCAAGCTC
GTGAGGCTTTGCAAGGAGGACACAGCCTTCAACTCCTATGTAGAGGTGCCCATTGGCTGTGAGCGCAGTG
GGGTGGAGTACCGCCTGCTGCAGGCTGCCTACCTGTCCAAAGCGGGGGCCGTGCTTGGCAGGACCCTTGG
AGTCCATCCAGATGATGACCTGCTCTTCACCGTCTTCTCCAAGGGCCAGAAGCGGAAAATGAAATCCCTG
GATGAGTCGGCCCTGTGCATCTTCATCTTGAAGCAGATAAATGACCGCATTAAGGAGCGGCTGCAGTCTT
GTTACCGGGGCGAGGGCACGCTGGACCTGGCCTGGCTCAAGGTGAAGGACATCCCCTGCAGCAGTGCGCT
CTTAACCATTGACGATAACTTCTGTGGCCTGGACATGAATGCTCCCCTGGGAGTGTCCGACATGGTGCGT
GGAATTCCCGTCTTCACGGAGGACAGGGACCGCATGACGTCTGTCATCGCATATGTCTACAAGAACCACT
CTCTGGCCTTTGTGGGCACCAAAAGTGGCAAGCTGAAGAAGATCCGGGTGGATGGACCCAGGGGCAACGC
CCTCCAGTATGAGACGGTGCAGGTGGTGGACCCCGGCCCAGTCCTCCGGGATATGGCCTTCTCCAAGGAC
CACGAGCAACTCTACATCATGTCAGAGAGGCAGCTCACCAGAGTCCCTGTGGAGTCCTGTGGTCAGTATC
AGAGCTGCGGCGAGTGCCTTGGCTCAGGCGACCCCCACTGTGGCTGGTGTGTGCTGCACAACACTTGCAC
CCGGAAGGAGCGGTGTGAGCGGTCCAAGGAGCCCCGCAGGTTTGCCTCGGAGATGAAGCAGTGTGTCCGG
CTGACGGTCCATCCCAACAATATCTCCGTCTCTCAGTACAACGTGCTGCTGGTCCTGGAGACGTACAATG
TCCCGGAGCTGTCAGCTGGCGTCAACTGCACCTTTGAGGACCTGTCAGAGATGGATGGGCTGGTCGTGGG
CAATCAGATCCAGTGCTACTCCCCTGCAGCCAAGGAGGTGCCCCGGATCATCACAGAGAATGGGGACCAC
CATGTCGTACAGCTTCAGCTCAAATCAAAGGAGACCGGCATGACCTTCGCCAGCACCAGCTTTGTCTTCT
ACAATTGCAGCGTCCACAATTCGTGCCTGTCCTGCGTGGAGAGTCCATACCGCTGCCACTGGTGTAAATA
CCGGCATGTCTGCACCCATGACCCCAAGACCTGCTCCTTCCAGGAAGGCCGAGTGAAGCTGCCCGAGGAC
TGCCCCCAGCTGCTGCGAGTGGACAAGATCCTGGTGCCCGTGGAGGTGATCAAGCCTATCACGCTGAAGG
CCAAGAACCTCCCCCAGCCCCAGTCTGGGCAGCGTGGCTACGAATGCATCCTCAACATTCAGGGCAGCGA
GCAGCGAGTGCCCGCCCTGCGCTTCAACAGCTCCAGCGTACAGTGCCAGAACACCTCTTATTCCTATGAA
GGGATGGAGATCAACAACCTGCCCGTGGAGTTGACAGTCGTGTGGAATGGGCACTTCAACATTGACAACC
CAGCTCAGAATAAAGTTCACCTCTACAAGTGTGGAGCCATGCGTGAGAGCTGCGGGCTGTGCCTCAAGGC
TGACCCAGACTTCGCATGTGGCTGGTGCCAGGGCCCAGGCCAGTGCACCCTGCGCCAGCACTGCCCTGCC
CAGGAGAGCCAGTGGCTGGAGCTGTCTGGTGCCAAAAGCAAGTGCACAAACCCCCGCATCACAGAGATAA
TCCCGGTGACAGGCCCCCGGGAAGGGGGCACCAAGGTCACTATCCGAGGGGAGAACCTGGGCCTGGAATT
TCGCGACATCGCCTCCCATGTCAAGGTTGCTGGCGTGGAGTGCAGCCCTTTAGTGGATGGTTACATCCCT
GCAGAACAGATCGTGTGTGAGATGGGGGAGGCCAAGCCCAGCCAGCATGCAGGCTTCGTGGAGATCTGCG
TGGCTGTGTGTCGGCCTGAATTCATGGCCCGGTCCTCACAGCTCTATTACTTCATGACACTGACTCTCTC
AGATCTGAAGCCCAGCCGGGGGCCCATGTCCGGAGGGACCCAAGTGACCATCACAGGCACCAACCTGAAT
GCCGGAAGCAACGTGGTGGTGATGTTTGGAAAGCAGCCCTGTCTCTTCCACAGGCGATCTCCATCCTACA
TTGTCTGCAACACCACATCCTCAGATGAGGTGCTAGAGATGAAGGTGTCGGTGCAGGTGGACAGGGCCAA
GATCCACCAGGACCTGGTCTTTCAGTATGTGGAAGACCCCACCATCGTGCGGATTGAGCCAGAATGGAGC
ATTGTCAGTGGAAACACACCCATCGCCGTATGGGGGACCCACCTGGACCTCATACAGAACCCCCAGATCC
GTGCCAAGCATGGAGGGAAGGAGCACATCAATATCTGTGAGGTTCTGAACGCTACTGAGATGACCTGTCA
GGCGCCCGCCCTCGCTCTGGGTCCTGACCACCAGTCAGACCTGACCGAGAGGCCCGAGGAGTTTGGCTTC
ATCCTGGACAACGTCCAGTCCCTGCTCATCCTCAACAAGACCAACTTCACCTACTATCCCAACCCGGTGT
TTGAGGCCTTTGGTCCCTCAGGAATCCTGGAGCTCAAGCCTGGCACGCCCATCATCCTAAAGGGCAAGAA
CCTGATCCCGCCTGTGGCTGGGGGCAACGTGAAGCTGAACTACACTGTGCTGGTTGGGGAGAAGCCGTGC
ACCGTGACCGTGTCAGATGTCCAGCTGCTCTGCGAGTCCCCCAACCTCATCGGCAGGCACAAAGTGATGG
CCCGTGTCGGTGGCATGGAGTACTCCCCGGGGATGGTGTACATTGCCCCGGACAGCCCGCTCAGCCTGCC
CGCCATCGTCAGCATCGCAGTGGCTGGCGGCCTCCTCATCATTTTCATCGTGGCCGTGCTCATTGCCTAT
AAACGCAAGTCCCGCGAAAGTGACCTCACGCTGAAGCGGCTGCAGATGCAGATGGACAACCTGGAGTCCC
GTGTGGCCCTGGAGTGCAAGGAAGCCTTTGCCGAGCTGCAGACGGACATCCATGAGCTGACCAGTGACCT
GGATGGAGCCGGGATTCCGTTCCTGGACTATAGAACTTACACCATGCGGGTGCTGTTCCCAGGAATTGAA
GACCACCCTGTCCTCCGGGACCTTGAGGTCCCGGGCTACCGGCAGGAGCGTGTGGAGAAAGGCCTGAAGC
TCTTCGCCCAGCTCATCAACAACAAGGTGTTCCTGCTGTCCTTCATCCGCACGCTTGAGTCCCAGCGTAG
CTTCTCCATGCGCGACCGTGGCAACGTGGCCTCACTCATCATGACCGTGCTGCAGAGCAAGCTGGAGTAC
GCCACTGATGTGCTGAAGCAGCTGCTGGCCGACCTCATTGACAAGAACCTGGAGAGCAAGAACCACCCTA
AGCTGCTGCTCAGGAGGACTGAGTCAGTGGCTGAGAAGATGCTGACCAATTGGTTTACTTTCCTCCTCTA
CAAGTTCCTCAAGGAGTGTGCTGGGGAGCCCCTCTTCTCCCTGTTCTGTGCCATCAAGCAGCAGATGGAG
AAGGGCCCCATTGACGCCATCACGGGCGAGGCCCGCTACTCCTTGAGCGAGGACAAGCTCATCCGCCAGC
AGATTGACTACAAAACCCTGGTCCTGAGCTGTGTCAGCCCAGACAATGCCAACAGCCCCGAGGTCCCAGT
AAAGATCCTCAACTGTGACACCATCACTCAGGTCAAGGAGAAGATTCTGGATGCCATCTTCAAGAATGTG
CCTTGCTCCCACCGGCCCAAAGCTGCAGATATGGATCTGGAGTGGCGACAAGGAAGTGGGGCAAGGATGA
TCTTGCAGGATGAAGACATCACCACCAAGATTGAGAATGATTGGAAGCGACTGAACACACTGGCCCACTA
CCAGGTGCCAGATGGTTCCGTGGTGGCATTAGTGTCCAAGCAGGTGACAGCCTATAACGCAGTGAACAAC
TCCACCGTCTCCAGGACCTCAGCAAGTAAATATGAAAACATGATCCGGTACACGGGCAGCCCCGACAGCC
TCCGCTCACGGACACCTATGATCACTCCTGACCTGGAGAGTGGAGTCAAGATGTGGCACCTAGTGAAGAA
CCACGAGCACGGAGACCAGAAGGAGGGGGACCGGGGGAGCAAGATGGTGTCTGAAATCTACCTGACCCGA
CTCCTGGCCACTAAGGGCACACTGCAGAAGTTTGTGGATGACCTCTTTGAGACCATCTTCAGCACGGCAC
ACCGTGGCTCTGCCCTGCCCCTGGCCATCAAGTACATGTTTGACTTCCTGGATGAGCAGGCTGATAAACA
TGGCATTCATGACCCGCACGTCCGCCATACCTGGAAGAGCAATTGCCTGCCCCTGAGGTTTTGGGTCAAC
ATGATCAAGAACCCGCAGTTTGTGTTTGACATCCATAAGAACAGCATCACAGACGCCTGCCTCTCTGTGG
TGGCTCAGACCTTCATGGACTCTTGCTCCACGTCAGAGCACCGGCTGGGCAAGGACTCGCCCTCCAACAA
GCTGCTGTATGCCAAGGACATCCCCAGCTACAAGAATTGGGTGGAGAGGTATTACTCAGACATAGGGAAG
ATGCCAGCCATCAGCGACCAAGACATGAACGCATACCTGGCTGAGCAGTCCCGGATGCACATGAATGAGT
TCAACACCATGAGTGCACTCTCAGAGATCTTCTCCTATGTGGGCAAATACAGCGAGGAGATCCTTGGACC
TCTGGACCACGATGACCAGTGTGGGAAGCAGAAACTGGCCTACAAACTAGAACAAGTCATAACCCTCATG
AGCTTAGACAGC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC226436 representing NM_020911
Red=Cloning site Green=Tags(s)

MKAMPWNWTCLLSHLLMVGMGSSTLLTRQPAPLSQKQRSFVTFRGEPAEGFNHLVVDERTGHIYLGAVNR
IYKLSSDLKVLVTHETGPDEDNPKCYPPRIVQTCNEPLTTTNNVNKMLLIDYKENRLIACGSLYQGICKL
LRLEDLFKLGEPYHKKEHYLSGVNESGSVFGVIVSYSNLDDKLFIATAVDGKPEYFPTISSRKLTKNSEA
DGMFAYVFHDEFVASMIKIPSDTFTIIPDFDIYYVYGFSSGNFVYFLTLQPEMVSPPGSTTKEQVYTSKL
VRLCKEDTAFNSYVEVPIGCERSGVEYRLLQAAYLSKAGAVLGRTLGVHPDDDLLFTVFSKGQKRKMKSL
DESALCIFILKQINDRIKERLQSCYRGEGTLDLAWLKVKDIPCSSALLTIDDNFCGLDMNAPLGVSDMVR
GIPVFTEDRDRMTSVIAYVYKNHSLAFVGTKSGKLKKIRVDGPRGNALQYETVQVVDPGPVLRDMAFSKD
HEQLYIMSERQLTRVPVESCGQYQSCGECLGSGDPHCGWCVLHNTCTRKERCERSKEPRRFASEMKQCVR
LTVHPNNISVSQYNVLLVLETYNVPELSAGVNCTFEDLSEMDGLVVGNQIQCYSPAAKEVPRIITENGDH
HVVQLQLKSKETGMTFASTSFVFYNCSVHNSCLSCVESPYRCHWCKYRHVCTHDPKTCSFQEGRVKLPED
CPQLLRVDKILVPVEVIKPITLKAKNLPQPQSGQRGYECILNIQGSEQRVPALRFNSSSVQCQNTSYSYE
GMEINNLPVELTVVWNGHFNIDNPAQNKVHLYKCGAMRESCGLCLKADPDFACGWCQGPGQCTLRQHCPA
QESQWLELSGAKSKCTNPRITEIIPVTGPREGGTKVTIRGENLGLEFRDIASHVKVAGVECSPLVDGYIP
AEQIVCEMGEAKPSQHAGFVEICVAVCRPEFMARSSQLYYFMTLTLSDLKPSRGPMSGGTQVTITGTNLN
AGSNVVVMFGKQPCLFHRRSPSYIVCNTTSSDEVLEMKVSVQVDRAKIHQDLVFQYVEDPTIVRIEPEWS
IVSGNTPIAVWGTHLDLIQNPQIRAKHGGKEHINICEVLNATEMTCQAPALALGPDHQSDLTERPEEFGF
ILDNVQSLLILNKTNFTYYPNPVFEAFGPSGILELKPGTPIILKGKNLIPPVAGGNVKLNYTVLVGEKPC
TVTVSDVQLLCESPNLIGRHKVMARVGGMEYSPGMVYIAPDSPLSLPAIVSIAVAGGLLIIFIVAVLIAY
KRKSRESDLTLKRLQMQMDNLESRVALECKEAFAELQTDIHELTSDLDGAGIPFLDYRTYTMRVLFPGIE
DHPVLRDLEVPGYRQERVEKGLKLFAQLINNKVFLLSFIRTLESQRSFSMRDRGNVASLIMTVLQSKLEY
ATDVLKQLLADLIDKNLESKNHPKLLLRRTESVAEKMLTNWFTFLLYKFLKECAGEPLFSLFCAIKQQME
KGPIDAITGEARYSLSEDKLIRQQIDYKTLVLSCVSPDNANSPEVPVKILNCDTITQVKEKILDAIFKNV
PCSHRPKAADMDLEWRQGSGARMILQDEDITTKIENDWKRLNTLAHYQVPDGSVVALVSKQVTAYNAVNN
STVSRTSASKYENMIRYTGSPDSLRSRTPMITPDLESGVKMWHLVKNHEHGDQKEGDRGSKMVSEIYLTR
LLATKGTLQKFVDDLFETIFSTAHRGSALPLAIKYMFDFLDEQADKHGIHDPHVRHTWKSNCLPLRFWVN
MIKNPQFVFDIHKNSITDACLSVVAQTFMDSCSTSEHRLGKDSPSNKLLYAKDIPSYKNWVERYYSDIGK
MPAISDQDMNAYLAEQSRMHMNEFNTMSALSEIFSYVGKYSEEILGPLDHDDQCGKQKLAYKLEQVITLM
SLDS

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_020911
ORF Size 5682 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_020911.1, NP_065962.1
RefSeq ORF 5685 bp
Locus ID 91584
UniProt ID Q9HCM2
Cytogenetics 7q32.3
Protein Families Druggable Genome
MW 212.3 kDa
Gene Summary Coreceptor for SEMA3A. Necessary for signaling by class 3 semaphorins and subsequent remodeling of the cytoskeleton. Plays a role in axon guidance in the developing nervous system. Class 3 semaphorins bind to a complex composed of a neuropilin and a plexin. The plexin modulates the affinity of the complex for specific semaphorins, and its cytoplasmic domain is required for the activation of down-stream signaling events in the cytoplasm (By similarity).[UniProtKB/Swiss-Prot Function]
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.