DNMT1 (NM_001130823) Human Tagged ORF Clone

CAT#: RC226414

DNMT1 (Myc-DDK-tagged)-Human DNA (cytosine-5-)-methyltransferase 1 (DNMT1), transcript variant 1

Change vector?

  • TrueORF®

USD 824


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name DNMT1 (NM_001130823) Human Tagged ORF Clone
Symbol DNMT1
Synonyms ADCADN; AIM; CXXC9; DNMT; HSN1E; m.HsaI; MCMT
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC226414 representing NM_001130823
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCCGGCGCGTACCGCCCCAGCCCGGGTGCCCACACTGGCCGTCCCGGCCATCTCGCTGCCCGACGATG
TCCGCAGGCGGCTCAAAGATTTGGAAAGAGACAGCTTAACAGAAAAGGAATGTGTGAAGGAGAAATTGAA
TCTCTTGCACGAATTTCTGCAAACAGAAATAAAGAATCAGTTATGTGACTTGGAAACCAAATTACGTAAA
GAAGAATTATCCGAGGAGGGCTACCTGGCTAAAGTCAAATCCCTTTTAAATAAAGATTTGTCCTTGGAGA
ACGGTGCTCATGCTTACAACCGGGAAGTGAATGGACGTCTAGAAAACGGGAACCAAGCAAGAAGTGAAGC
CCGTAGAGTGGGAATGGCAGATGCCAACAGCCCCCCCAAACCCCTTTCCAAACCTCGCACGCCCAGGAGG
AGCAAGTCCGATGGAGAGGCTAAGCGTTCAAGAGACCCTCCTGCCTCAGCCTCCCAAGTAACTGGGATTA
GAGCTGAACCTTCACCTAGCCCCAGGATTACAAGGAAAAGCACCAGGCAAACCACCATCACATCTCATTT
TGCAAAGGGCCCTGCCAAACGGAAACCTCAGGAAGAGTCTGAAAGAGCCAAATCGGATGAGTCCATCAAG
GAAGAAGACAAAGACCAGGATGAGAAGAGACGTAGAGTTACATCCAGAGAACGAGTTGCTAGACCGCTTC
CTGCAGAAGAACCTGAAAGAGCAAAATCAGGAACGCGCACTGAAAAGGAAGAAGAAAGAGATGAAAAAGA
AGAAAAGAGACTCCGAAGTCAAACCAAAGAACCAACACCCAAACAGAAACTGAAGGAGGAGCCGGACAGA
GAAGCCAGGGCAGGCGTGCAGGCTGACGAGGACGAAGATGGAGACGAGAAAGATGAGAAGAAGCACAGAA
GTCAACCCAAAGATCTAGCTGCCAAACGGAGGCCCGAAGAAAAAGAACCTGAAAAAGTAAATCCACAGAT
TTCTGATGAAAAAGACGAGGATGAAAAGGAGGAGAAGAGACGCAAAACGACCCCCAAAGAACCAACGGAG
AAAAAAATGGCTCGCGCCAAAACAGTCATGAACTCCAAGACCCACCCTCCCAAGTGCATTCAGTGCGGGC
AGTACCTGGACGACCCTGACCTCAAATATGGGCAGCACCCACCAGACGCGGTGGATGAGCCACAGATGCT
GACAAATGAGAAGCTGTCCATCTTTGATGCCAACGAGTCTGGCTTTGAGAGTTATGAGGCGCTTCCCCAG
CACAAACTGACCTGCTTCAGTGTGTACTGTAAGCACGGTCACCTGTGTCCCATCGACACCGGCCTCATCG
AGAAGAATATCGAACTCTTCTTTTCTGGTTCAGCAAAACCAATCTATGATGATGACCCATCTCTTGAAGG
TGGTGTTAATGGCAAAAATCTTGGCCCCATAAATGAATGGTGGATCACTGGCTTTGATGGAGGTGAAAAG
GCCCTCATCGGCTTCAGCACCTCATTTGCCGAATACATTCTGATGGATCCCAGTCCCGAGTATGCGCCCA
TATTTGGGCTGATGCAGGAGAAGATCTACATCAGCAAGATTGTGGTGGAGTTCCTGCAGAGCAATTCCGA
CTCGACCTATGAGGACCTGATCAACAAGATCGAGACCACGGTTCCTCCTTCTGGCCTCAACTTGAACCGC
TTCACAGAGGACTCCCTCCTGCGACACGCGCAGTTTGTGGTGGAGCAGGTGGAGAGTTATGACGAGGCCG
GGGACAGTGATGAGCAGCCCATCTTCCTGACACCCTGCATGCGGGACCTGATCAAGCTGGCTGGGGTCAC
GCTGGGACAGAGGCGAGCCCAGGCGAGGCGGCAGACCATCAGGCATTCTACCAGGGAGAAGGACAGGGGA
CCCACGAAAGCCACCACCACCAAGCTGGTCTACCAGATCTTCGATACTTTCTTCGCAGAGCAAATTGAAA
AGGATGACAGAGAAGACAAGGAGAACGCCTTTAAGCGCCGGCGATGTGGCGTCTGTGAGGTGTGTCAGCA
GCCTGAGTGTGGGAAATGTAAAGCCTGCAAGGACATGGTTAAATTTGGTGGCAGTGGACGGAGCAAGCAG
GCTTGCCAAGAGCGGAGGTGTCCCAATATGGCCATGAAGGAGGCAGATGACGATGAGGAAGTCGATGATA
ACATCCCAGAGATGCCGTCACCCAAAAAAATGCACCAGGGGAAGAAGAAGAAACAGAACAAGAATCGCAT
CTCTTGGGTCGGAGAAGCCGTCAAGACTGATGGGAAGAAGAGTTACTATAAGAAGGTGTGCATTGATGCG
GAAACCCTGGAAGTGGGGGACTGTGTCTCTGTTATTCCAGATGATTCCTCAAAACCGCTGTATCTAGCAA
GGGTCACGGCGCTGTGGGAGGACAGCAGCAACGGGCAGATGTTTCACGCCCACTGGTTCTGCGCTGGGAC
AGACACAGTCCTCGGGGCCACGTCGGACCCTCTGGAGCTGTTCTTGGTGGATGAATGTGAGGACATGCAG
CTTTCATATATCCACAGCAAAGTGAAAGTCATCTACAAAGCCCCCTCCGAAAACTGGGCCATGGAGGGAG
GCATGGATCCCGAGTCCCTGCTGGAGGGGGACGACGGGAAGACCTACTTCTACCAGCTGTGGTATGATCA
AGACTACGCGAGATTCGAGTCCCCTCCAAAAACCCAGCCAACAGAGGACAACAAGTTCAAATTCTGTGTG
AGCTGTGCCCGTCTGGCTGAGATGAGGCAAAAAGAAATCCCCAGGGTCCTGGAGCAGCTCGAGGACCTGG
ATAGCCGGGTCCTCTACTACTCAGCCACCAAGAACGGCATCCTGTACCGAGTTGGTGATGGTGTGTACCT
GCCCCCTGAGGCCTTCACGTTCAACATCAAGCTGTCCAGTCCCGTGAAACGCCCACGGAAGGAGCCCGTG
GATGAGGACCTGTACCCAGAGCACTACCGGAAATACTCCGACTACATCAAAGGCAGCAACCTGGATGCCC
CTGAGCCCTACCGAATTGGCCGGATCAAAGAGATCTTCTGTCCCAAGAAGAGCAACGGCAGGCCCAATGA
GACTGACATCAAAATCCGGGTCAACAAGTTCTACAGGCCTGAGAACACCCACAAGTCCACTCCAGCGAGC
TACCACGCAGACATCAACCTGCTCTACTGGAGCGACGAGGAGGCCGTGGTGGACTTCAAGGCTGTGCAGG
GCCGCTGCACCGTGGAGTATGGGGAGGACCTGCCCGAGTGCGTCCAGGTGTACTCCATGGGCGGCCCCAA
CCGCTTCTACTTCCTCGAGGCCTATAATGCAAAGAGCAAAAGCTTTGAAGATCCTCCCAACCATGCCCGT
AGCCCTGGAAACAAAGGGAAGGGCAAGGGAAAAGGGAAGGGCAAGCCCAAGTCCCAAGCCTGTGAGCCGA
GCGAGCCAGAGATAGAGATCAAGCTGCCCAAGCTGCGGACCCTGGATGTGTTTTCTGGCTGCGGGGGGTT
GTCGGAGGGATTCCACCAAGCAGGCATCTCTGACACGCTGTGGGCCATCGAGATGTGGGACCCTGCGGCC
CAGGCGTTCCGGCTGAACAACCCCGGCTCCACAGTGTTCACAGAGGACTGCAACATCCTGCTGAAGCTGG
TCATGGCTGGGGAGACCACCAACTCCCGCGGCCAGCGGCTGCCCCAGAAGGGAGACGTGGAGATGCTGTG
CGGCGGGCCGCCCTGCCAGGGCTTCAGCGGCATGAACCGCTTCAATTCGCGCACCTACTCCAAGTTCAAA
AACTCTCTGGTGGTTTCCTTCCTCAGCTACTGCGACTACTACCGGCCCCGGTTCTTCCTCCTGGAGAATG
TCAGGAACTTTGTCTCCTTCAAGCGCTCCATGGTCCTGAAGCTCACCCTCCGCTGCCTGGTCCGCATGGG
CTATCAGTGCACCTTCGGCGTGCTGCAGGCCGGTCAGTACGGCGTGGCCCAGACTAGGAGGCGGGCCATC
ATCCTGGCCGCGGCCCCTGGAGAGAAGCTCCCTCTGTTCCCGGAGCCACTGCACGTGTTTGCTCCCCGGG
CCTGCCAGCTGAGCGTGGTGGTGGATGACAAGAAGTTTGTGAGCAACATAACCAGGTTGAGCTCGGGTCC
TTTCCGGACCATCACGGTGCGAGACACGATGTCCGACCTGCCGGAGGTGCGGAATGGAGCCTCGGCACTG
GAGATCTCCTACAACGGGGAGCCTCAGTCCTGGTTCCAGAGGCAGCTCCGGGGCGCACAGTACCAGCCCA
TCCTCAGGGACCACATCTGTAAGGACATGAGTGCATTGGTGGCTGCCCGCATGCGGCACATCCCCTTGGC
CCCAGGGTCAGACTGGCGCGATCTGCCCAACATCGAGGTGCGGCTCTCAGACGGCACCATGGCCAGGAAG
CTGCGGTATACCCACCATGACAGGAAGAACGGCCGCAGCAGCTCTGGGGCCCTCCGTGGGGTCTGCTCCT
GCGTGGAAGCCGGCAAAGCCTGCGACCCCGCAGCCAGGCAGTTCAACACCCTCATCCCCTGGTGCCTGCC
CCACACCGGGAACCGGCACAACCACTGGGCTGGCCTCTATGGAAGGCTCGAGTGGGACGGCTTCTTCAGC
ACAACCGTCACCAACCCCGAGCCCATGGGCAAGCAGGGCCGCGTGCTCCACCCAGAGCAGCACCGTGTGG
TGAGCGTGCGGGAGTGTGCCCGCTCCCAGGGCTTCCCTGACACCTACCGGCTCTTCGGCAACATCCTGGA
CAAGCACCGGCAGGTGGGCAATGCCGTGCCACCGCCCCTGGCCAAAGCCATTGGCTTGGAGATCAAGCTT
TGTATGTTGGCCAAAGCCCGAGAGAGTGCCTCAGCTAAAATAAAGGAGGAGGAAGCTGCTAAGGAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC226414 representing NM_001130823
Red=Cloning site Green=Tags(s)

MPARTAPARVPTLAVPAISLPDDVRRRLKDLERDSLTEKECVKEKLNLLHEFLQTEIKNQLCDLETKLRK
EELSEEGYLAKVKSLLNKDLSLENGAHAYNREVNGRLENGNQARSEARRVGMADANSPPKPLSKPRTPRR
SKSDGEAKRSRDPPASASQVTGIRAEPSPSPRITRKSTRQTTITSHFAKGPAKRKPQEESERAKSDESIK
EEDKDQDEKRRRVTSRERVARPLPAEEPERAKSGTRTEKEEERDEKEEKRLRSQTKEPTPKQKLKEEPDR
EARAGVQADEDEDGDEKDEKKHRSQPKDLAAKRRPEEKEPEKVNPQISDEKDEDEKEEKRRKTTPKEPTE
KKMARAKTVMNSKTHPPKCIQCGQYLDDPDLKYGQHPPDAVDEPQMLTNEKLSIFDANESGFESYEALPQ
HKLTCFSVYCKHGHLCPIDTGLIEKNIELFFSGSAKPIYDDDPSLEGGVNGKNLGPINEWWITGFDGGEK
ALIGFSTSFAEYILMDPSPEYAPIFGLMQEKIYISKIVVEFLQSNSDSTYEDLINKIETTVPPSGLNLNR
FTEDSLLRHAQFVVEQVESYDEAGDSDEQPIFLTPCMRDLIKLAGVTLGQRRAQARRQTIRHSTREKDRG
PTKATTTKLVYQIFDTFFAEQIEKDDREDKENAFKRRRCGVCEVCQQPECGKCKACKDMVKFGGSGRSKQ
ACQERRCPNMAMKEADDDEEVDDNIPEMPSPKKMHQGKKKKQNKNRISWVGEAVKTDGKKSYYKKVCIDA
ETLEVGDCVSVIPDDSSKPLYLARVTALWEDSSNGQMFHAHWFCAGTDTVLGATSDPLELFLVDECEDMQ
LSYIHSKVKVIYKAPSENWAMEGGMDPESLLEGDDGKTYFYQLWYDQDYARFESPPKTQPTEDNKFKFCV
SCARLAEMRQKEIPRVLEQLEDLDSRVLYYSATKNGILYRVGDGVYLPPEAFTFNIKLSSPVKRPRKEPV
DEDLYPEHYRKYSDYIKGSNLDAPEPYRIGRIKEIFCPKKSNGRPNETDIKIRVNKFYRPENTHKSTPAS
YHADINLLYWSDEEAVVDFKAVQGRCTVEYGEDLPECVQVYSMGGPNRFYFLEAYNAKSKSFEDPPNHAR
SPGNKGKGKGKGKGKPKSQACEPSEPEIEIKLPKLRTLDVFSGCGGLSEGFHQAGISDTLWAIEMWDPAA
QAFRLNNPGSTVFTEDCNILLKLVMAGETTNSRGQRLPQKGDVEMLCGGPPCQGFSGMNRFNSRTYSKFK
NSLVVSFLSYCDYYRPRFFLLENVRNFVSFKRSMVLKLTLRCLVRMGYQCTFGVLQAGQYGVAQTRRRAI
ILAAAPGEKLPLFPEPLHVFAPRACQLSVVVDDKKFVSNITRLSSGPFRTITVRDTMSDLPEVRNGASAL
EISYNGEPQSWFQRQLRGAQYQPILRDHICKDMSALVAARMRHIPLAPGSDWRDLPNIEVRLSDGTMARK
LRYTHHDRKNGRSSSGALRGVCSCVEAGKACDPAARQFNTLIPWCLPHTGNRHNHWAGLYGRLEWDGFFS
TTVTNPEPMGKQGRVLHPEQHRVVSVRECARSQGFPDTYRLFGNILDKHRQVGNAVPPPLAKAIGLEIKL
CMLAKARESASAKIKEEEAAKD

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_001130823
ORF Size 4896 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_001130823.1, NM_001130823.2, NP_001124295
RefSeq ORF 4899
Locus ID 1786
Cytogenetics 19p13.2
Protein Families Transcription Factors, Druggable Genome
Protein Pathways Cysteine and methionine metabolism, Metabolic pathways
MW 184.6 kDa
Gene Summary This gene encodes an enzyme that transfers methyl groups to cytosine nucleotides of genomic DNA. This protein is the major enzyme responsible for maintaining methylation patterns following DNA replication and shows a preference for hemi-methylated DNA. Methylation of DNA is an important component of mammalian epigenetic gene regulation. Aberrant methylation patterns are found in human tumors and associated with developmental abnormalities. Variation in this gene has been associated with cerebellar ataxia, deafness, and narcolepsy, and neuropathy, hereditary sensory, type IE. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2016].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations