JLP(SPAG9) (NM_001130528) Human Tagged ORF Clone

CAT#: RC226382

SPAG9 (Myc-DDK-tagged)-Human sperm associated antigen 9 (SPAG9), transcript variant 1

  • TrueORF®

Need custom modification / cloning service?
Get a free quote

USD 869.00


Availability*
In Stock

Size
    • 10 ug

Cited in 3 publications.

Product images

Specifications

Product Data
Product Name JLP(SPAG9) (NM_001130528) Human Tagged ORF Clone
Symbol SPAG9
Synonyms CT89; HLC-6; HLC4; HLC6; JIP-4; JIP4; JLP; PHET; PIG6
Vector pCMV6-Entry
Sequence Data
>RC226382 representing NM_001130528
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAGCTGGAGGACGGTGTGGTGTATCAGGAGGAGCCCGGCGGCTCCGGGGCCGTGATGTCGGAGCGGG
TGTCCGGCCTGGCCGGCTCCATCTACCGCGAGTTCGAGCGGCTTATCGGGCGCTATGACGAGGAGGTGGT
CAAAGAGCTGATGCCGCTGGTGGTGGCTGTGCTGGAGAACCTGGACTCGGTGTTCGCGCAGGACCAGGAG
CACCAGGTGGAGCTGGAGCTGCTGCGGGACGACAACGAGCAGCTCATCACCCAGTACGAGCGGGAGAAGG
CGCTGCGCAAGCACGCTGAGGAGAAATTCATTGAATTTGAAGACTCTCAAGAACAGGAAAAAAAGGACTT
ACAGACCCGAGTGGAATCTTTAGAATCTCAAACAAGACAACTTGAGCTGAAAGCGAAAAACTATGCTGAC
CAGATTAGCAGACTTGAAGAAAGAGAAGCAGAACTGAAGAAGGAATATAATGCATTACATCAAAGACACA
CTGAGATGATCCATAATTATATGGAACATTTAGAAAGAACAAAACTTCATCAGCTCTCAGGGAGTGATCA
ACTAGAATCCACAGCTCATAGTAGAATTAGAAAAGAACGCCCTATATCATTAGGAATTTTCCCATTACCT
GCTGGAGATGGATTGCTTACACCTGATGCTCAGAAAGGAGGAGAGACCCCTGGATCTGAGCAATGGAAAT
TTCAGGAATTAAGTCAACCACGTTCTCATACCAGCCTGAAGGTCAGCAATAGTCCTGAACCTCAGAAGGC
TGTAGAACAGGAGGATGAGCTTTCTGATGTTAGCCAAGGCGGATCTAAAGCTACCACTCCAGCATCAACA
GCTAATTCAGATGTGGCAACAATTCCTACTGATACTCCCTTAAAGGAAGAAAACGAAGGATTTGTGAAGG
TTACAGATGCGCCAAATAAATCAGAGATAAGCAAACACATTGAAGTACAGGTAGCCCAGGAAACTAGAAA
TGTATCTACTGGCTCTGCTGAAAATGAAGAAAAGTCAGAAGTTCAAGCAATCATCGAATCTACTCCTGAG
CTGGATATGGACAAAGATCTCAGTGGATATAAAGGTTCAAGCACTCCCACCAAAGGCATAGAGAACAAAG
CTTTTGATCGCAATACAGAATCTCTCTTTGAAGAACTGTCTTCAGCTGGCTCAGGCCTAATAGGAGATGT
GGATGAAGGAGCAGATTTACTAGGAATGGGTCGGGAAGTTGAGAATCTTATATTAGAAAATACACAACTG
TTGGAAACCAAAAATGCTTTGAACATAGTGAAGAATGATTTGATAGCAAAAGTGGATGAACTGACCTGTG
AGAAAGATGTGCTGCAAGGGGAATTGGAGGCTGTGAAGCAAGCCAAACTGAAACTAGAGGAAAAGAACAG
AGAATTGGAGGAAGAGCTTAGGAAAGCTCGGGCAGAAGCTGAAGATGCAAGGCAAAAAGCAAAAGATGAC
GATGATAGTGATATTCCCACAGCCCAGAGGAAACGGTTTACTAGAGTAGAAATGGCCCGTGTTCTCATGG
AGCGAAACCAGTATAAAGAGAGATTGATGGAGCTTCAGGAAGCTGTTCGATGGACAGAGATGATTCGGGC
ATCACGAGAAAATCCAGCCATGCAGGAAAAAAAAAGGTCAAGCATTTGGCAGTTTTTCAGCCGACTTTTC
AGCTCCTCAAGTAACACGACTAAGAAGCCTGAACCACCTGTTAATCTGAAGTACAATGCACCCACGTCTC
ATGTTACTCCGTCCGTCAAGAAAAGAAGCAGCACCTTATCTCAGCTCCCTGGGGATAAGTCCAAAGCCTT
TGATTTCCTTAGTGAAGAAACTGAAGCTAGTTTAGCCTCACGCAGAGAACAAAAGAGAGAGCAGTATCGT
CAGGTAAAAGCACATGTTCAGAAGGAAGACGGTAGAGTGCAGGCTTTTGGCTGGAGTCTGCCTCAGAAGT
ACAAACAGGTAACCAATGGTCAAGGTGAAAATAAGATGAAAAATTTACCTGTGCCTGTCTATCTCAGACC
TCTGGATGAAAAAGATACATCAATGAAGCTGTGGTGTGCTGTTGGAGTCAATTTATCTGGTGGGAAGACC
AGAGATGGTGGTTCTGTTGTTGGAGCAAGTGTATTTTACAAGGATGTTGCTGGTTTGGATACAGAAGGCA
GTAAACAGCGAAGTGCCTCTCAGAGTAGTTTAGATAAGTTAGATCAGGAACTTAAGGAACAGCAGAAGGA
GTTAAAAAATCAAGAAGAATTATCCAGTCTAGTTTGGATCTGTACCAGCACTCATTCGGCTACAAAAGTT
CTTATTATTGATGCTGTTCAACCTGGCAACATCCTAGACAGTTTCACTGTTTGCAACTCTCATGTTCTGT
GCATTGCAAGTGTGCCAGGTGCACGAGAAACAGACTACCCTGCAGGAGAAGATCTTTCAGAATCTGGTCA
GGTAGACAAAGCATCTTTATGTGGAAGTATGACAAGCAACAGCTCAGCAGAGACAGACAGCCTGTTAGGA
GGCATCACAGTGGTTGGTTGTTCTGCAGAAGGTGTGACGGGAGCTGCCACTTCCCCTAGTACAAATGGTG
CTTCTCCAGTGATGGATAAACCACCAGAAATGGAAGCAGAAAATAGTGAGGTTGATGAAAATGTTCCAAC
AGCAGAAGAAGCAACTGAAGCTACAGAAGGGAATGCGGGGTCAGCTGAAGACACAGTGGACATCTCCCAA
ACTGGCGTCTACACAGAGCATGTCTTTACAGATCCTTTGGGAGTTCAGATCCCAGAAGACCTCTCCCCAG
TGTATCAGTCGAGCAATGACTCAGATGCATATAAAGATCAAATATCAGTACTGCCAAATGAACAAGACTT
GGTGAGAGAAGAAGCCCAGAAAATGAGTAGTCTTTTACCAACTATGTGGCTTGGAGCTCAAAATGGCTGT
TTGTATGTCCATTCATCTGTAGCCCAGTGGAGGAAATGTCTCCATTCCATTAAACTTAAAGATTCGATTC
TCAGTATTGTACACGTGAAGGGAATCGTGTTAGTAGCCCTGGCTGACGGCACCCTTGCAATCTTTCACAG
AGGAGTGGATGGGCAGTGGGATTTGTCAAACTATCACCTCTTAGACCTTGGACGGCCTCATCATTCCATC
CGTTGCATGACTGTGGTACATGACAAAGTCTGGTGTGGCTATAGGAACAAAATCTATGTGGTGCAGCCAA
AGGCCATGAAAATAGAGAAATCTTTTGATGCACATCCCAGGAAGGAGAGCCAAGTGCGACAGCTTGCGTG
GGTGGGGGATGGCGTGTGGGTCTCCATTCGCTTGGATTCTACGCTCCGTCTCTATCATGCACACACTTAT
CAACATCTACAGGATGTGGACATTGAGCCTTATGTAAGCAAAATGTTAGGTACTGGAAAACTGGGCTTCT
CTTTTGTGAGAATTACAGCTCTTATGGTGTCTTGTAATCGTTTGTGGGTGGGGACAGGAAATGGTGTCAT
TATCTCCATCCCATTGACAGAAACAAATAAAACCTCAGGTGTACCAGGAAATCGTCCTGGAAGTGTAATC
CGTGTATATGGTGATGAAAACAGTGATAAAGTGACTCCAGGGACATTTATACCCTATTGTTCAATGGCAC
ATGCACAGCTTTGCTTCCATGGGCACCGGGATGCTGTGAAATTCTTTGTGGCAGTCCCAGGTCAAGTCAT
CAGCCCACAAAGTAGCAGTAGTGGCACGGATCTGACGGGTGACAAAGCAGGGCCATCTGCACAGGAGCCT
GGTAGTCAGACGCCCTTGAAGTCTATGCTTGTCATCAGTGGAGGAGAGGGCTACATCGACTTCCGAATGG
GTGATGAAGGTGGAGAATCAGAACTTCTTGGAGAGGATCTTCCACTTGAACCTTCTGTCACCAAAGCAGA
AAGGAGTCACTTGATAGTGTGGCAAGTGATGTATGGCAATGAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC226382 representing NM_001130528
Red=Cloning site Green=Tags(s)

MELEDGVVYQEEPGGSGAVMSERVSGLAGSIYREFERLIGRYDEEVVKELMPLVVAVLENLDSVFAQDQE
HQVELELLRDDNEQLITQYEREKALRKHAEEKFIEFEDSQEQEKKDLQTRVESLESQTRQLELKAKNYAD
QISRLEEREAELKKEYNALHQRHTEMIHNYMEHLERTKLHQLSGSDQLESTAHSRIRKERPISLGIFPLP
AGDGLLTPDAQKGGETPGSEQWKFQELSQPRSHTSLKVSNSPEPQKAVEQEDELSDVSQGGSKATTPAST
ANSDVATIPTDTPLKEENEGFVKVTDAPNKSEISKHIEVQVAQETRNVSTGSAENEEKSEVQAIIESTPE
LDMDKDLSGYKGSSTPTKGIENKAFDRNTESLFEELSSAGSGLIGDVDEGADLLGMGREVENLILENTQL
LETKNALNIVKNDLIAKVDELTCEKDVLQGELEAVKQAKLKLEEKNRELEEELRKARAEAEDARQKAKDD
DDSDIPTAQRKRFTRVEMARVLMERNQYKERLMELQEAVRWTEMIRASRENPAMQEKKRSSIWQFFSRLF
SSSSNTTKKPEPPVNLKYNAPTSHVTPSVKKRSSTLSQLPGDKSKAFDFLSEETEASLASRREQKREQYR
QVKAHVQKEDGRVQAFGWSLPQKYKQVTNGQGENKMKNLPVPVYLRPLDEKDTSMKLWCAVGVNLSGGKT
RDGGSVVGASVFYKDVAGLDTEGSKQRSASQSSLDKLDQELKEQQKELKNQEELSSLVWICTSTHSATKV
LIIDAVQPGNILDSFTVCNSHVLCIASVPGARETDYPAGEDLSESGQVDKASLCGSMTSNSSAETDSLLG
GITVVGCSAEGVTGAATSPSTNGASPVMDKPPEMEAENSEVDENVPTAEEATEATEGNAGSAEDTVDISQ
TGVYTEHVFTDPLGVQIPEDLSPVYQSSNDSDAYKDQISVLPNEQDLVREEAQKMSSLLPTMWLGAQNGC
LYVHSSVAQWRKCLHSIKLKDSILSIVHVKGIVLVALADGTLAIFHRGVDGQWDLSNYHLLDLGRPHHSI
RCMTVVHDKVWCGYRNKIYVVQPKAMKIEKSFDAHPRKESQVRQLAWVGDGVWVSIRLDSTLRLYHAHTY
QHLQDVDIEPYVSKMLGTGKLGFSFVRITALMVSCNRLWVGTGNGVIISIPLTETNKTSGVPGNRPGSVI
RVYGDENSDKVTPGTFIPYCSMAHAQLCFHGHRDAVKFFVAVPGQVISPQSSSSGTDLTGDKAGPSAQEP
GSQTPLKSMLVISGGEGYIDFRMGDEGGESELLGEDLPLEPSVTKAERSHLIVWQVMYGNE

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_001130528
ORF Size 3963 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_001130528.1, NM_001130528.2, NP_001124000
RefSeq ORF 3966
Locus ID 9043
Cytogenetics 17q21.33
MW 146 kDa
Gene Summary This gene encodes a member of the cancer testis antigen gene family. The encoded protein functions as a scaffold protein that structurally organizes mitogen-activated protein kinases and mediates c-Jun-terminal kinase signaling. This protein also binds to kinesin-1 and may be involved in microtubule-based membrane transport. This protein may play a role in tumor growth and development. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Oct 2011].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (3)