Angiomotin(AMOT) (NM_001113490) Human Tagged ORF Clone

CAT#: RC226319

AMOT (Myc-DDK-tagged)-Human angiomotin (AMOT), transcript variant 1

Clone Modification / Custom Cloning Service

  • TrueORF®

USD 1,659.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name Angiomotin(AMOT) (NM_001113490) Human Tagged ORF Clone
Symbol AMOT
Synonyms KIAA1071
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC226319 representing NM_001113490
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAGAAATTCTGAAGAACAGCCAAGTGGAGGGACCACGGTATTGCAGCGTTTGCTACAAGAGCAGCTTC
GCTATGGCAATCCTAGTGAGAATCGCAGCCTGCTTGCCATACACCAGCAAGCCACAGGGAATGGCCCTCC
TTTCCCCAGTGGCAGTGGGAACCCGGGCCCTCAGAGTGATGTGTTGAGTCCCCAAGACCACCACCAACAG
CTTGTGGCTCATGCTGCTCGACAAGAACCCCAGGGGCAGGAAATCCAGTCAGAAAACCTCATCATGGAGA
AGCAGCTGTCTCCTCGAATGCAAAATAATGAAGAACTCCCGACCTATGAAGAAGCCAAGGTCCAGTCCCA
GTACTTTCGGGGCCAACAGCATGCCAGTGTTGGAGCTGCCTTCTATGTCACTGGAGTCACCAACCAGAAG
ATGAGGACTGAGGGACGCCCATCAGTTCAGCGGCTCAATCCTGGAAAGATGCACCAAGATGAGGGACTCA
GAGACCTTAAGCAAGGGCATGTCCGTTCCTTGAGTGAACGACTAATGCAGATGTCACTGGCCACCAGTGG
AGTTAAGGCCCATCCACCTGTTACCAGTGCTCCCCTCTCCCCACCACAACCCAATGACCTCTACAAGAAT
CCCACAAGTTCCAGTGAATTCTACAAGGCCCAAGGGCCACTTCCTAACCAGCATAGCCTGAAGGGCATGG
AACACCGAGGCCCCCCACCAGAATATCCCTTCAAGGGCATGCCACCCCAATCTGTAGTGTGCAAGCCCCA
AGAGCCAGGGCACTTCTATAGTGAGCATCGCCTGAACCAGCCAGGGAGAACAGAGGGGCAACTGATGAGG
TATCAGCATCCCCCTGAGTATGGAGCAGCCAGGCCAGCGCAGGACATCTCATTGCCATTGTCAGCCAGGA
ACTCGCAGCCTCACAGCCCTACTTCTTCTCTGACCTCTGGGGGGTCCTTGCCCTTGCTACAATCTCCACC
ATCCACTAGATTGTCTCCTGCCCGACACCCCTTGGTCCCAAACCAGGGAGACCATTCAGCTCACCTGCCT
AGGCCGCAGCAGCATTTCCTTCCTAATCAGGCTCACCAGGGGGATCATTACCGTCTCTCCCAACCTGGCC
TGAGTCAGCAGCAGCAGCAACAGCAGCAGCAGCACCATCATCACCATCACCACCAACAACAGCAGCAGCA
GCAGCCACAGCAGCAGCCAGGAGAAGCCTATTCAGCTATGCCTCGGGCTCAGCCATCCTCTGCTTCTTAT
CAGCCAGTGCCAGCAGACCCTTTTGCCATTGTTTCCAGAGCCCAGCAGATGGTTGAGATCCTCTCAGACG
AGAACCGGAACTTGAGGCAAGAGTTGGAAGGATGCTATGAGAAGGTGGCAAGACTGCAGAAGGTGGAGAC
AGAAATCCAGCGCGTCTCGGAGGCATATGAGAACCTCGTGAAGTCATCCTCCAAAAGAGAGGCCCTAGAG
AAAGCCATGAGAAACAAGCTAGAGGGCGAGATTCGGAGGATGCATGATTTCAACAGGGATCTGAGAGAGC
GTCTAGAGACTGCCAACAAGCAGCTTGCAGAGAAGGAATATGAGGGGTCAGAGGACACCAGAAAAACCAT
CTCGCAGCTCTTTGCAAAAAATAAAGAAAGCCAGCGTGAGAAGGAGAAGCTGGAAGCGGAGCTGGCCACT
GCCCGTTCTACCAATGAGGACCAAAGACGACACATCGAAATCCGAGATCAGGCCCTGAGTAATGCCCAGG
CCAAGGTGGTAAAGCTGGAAGAAGAGCTGAAAAAGAAGCAAGTGTACGTTGACAAGGTGGAGAAGATGCA
GCAGGCCCTTGTACAGCTCCAGGCAGCATGTGAAAAACGTGAGCAGCTAGAGCACCGTCTCCGGACACGA
CTGGAGAGGGAACTGGAATCCCTGAGAATCCAGCAGCGTCAGGGCAACTGTCAGCCCACCAACGTTTCAG
AATACAATGCTGCTGCACTGATGGAGCTCCTTCGGGAGAAAGAGGAGAGGATTCTGGCTCTGGAAGCTGA
TATGACAAAGTGGGAGCAGAAATATTTGGAGGAGAATGTGATGAGACATTTTGCTCTGGATGCTGCTGCA
ACTGTGGCTGCTCAGAGGGACACAACAGTCATCAGTCACTCTCCTAACACCAGCTATGACACAGCTCTAG
AAGCTCGCATCCAGAAAGAGGAGGAAGAAATCTTGATGGCCAATAAGCGTTGCCTTGACATGGAGGGCAG
GATTAAGACCCTCCATGCCCAGATTATTGAGAAGGATGCCATGATCAAAGTACTCCAGCAGCGTTCCCGG
AAGGAGCCGAGCAAGACAGAGCAGCTGTCGTGCATGCGGCCAGCGAAGTCTCTGATGTCCATTTCCAATG
CTGGATCAGGCTTGCTCTCCCACTCATCCACCCTGACTGGCTCCCCCATCATGGAAGAAAAGCGAGACGA
CAAGAGCTGGAAGGGGAGCCTAGGCATTCTCCTGGGTGGAGACTACCGTGCTGAATATGTCCCTTCCACA
CCCTCGCCTGTGCCACCCTCGACTCCCCTGCTCTCGGCTCACTCCAAGACAGGCAGCCGAGACTGCAGTA
CCCAAACTGAACGTGGGACGGAATCGAACAAAACTGCAGCTGTTGCTCCCATCTCTGTTCCTGCTCCAGT
TGCTGCTGCCGCCACTGCTGCCGCCATCACTGCCACTGCTGCCACCATCACCACCACCATGGTAGCTGCT
GCTCCAGTTGCTGTTGCTGCTGCTGCTGCTCCAGCTGCTGCTGCTGCCCCGTCTCCAGCCACTGCCGCTG
CTACTGCTGCTGCTGTTTCTCCAGCTGCTGCTGGTCAGATTCCAGCTGCTGCCTCTGTTGCCTCAGCTGC
TGCCGTTGCTCCTTCTGCTGCTGCTGCTGCTGCTGTTCAGGTTGCTCCAGCTGCTCCGGCTCCAGTTCCA
GCTCCGGCTCTGGTTCCGGTTCCAGCTCCAGCAGCGGCTCAGGCTTCTGCTCCTGCTCAGACTCAGGCAC
CAACTTCAGCTCCGGCTGTGGCTCCAACTCCAGCTCCAACTCCAACTCCAGCTGTGGCTCAGGCTGAGGT
TCCTGCAAGTCCAGCTACCGGTCCTGGACCACATCGTTTGTCTATACCAAGTTTGACCTGCAATCCAGAC
AAAACAGATGGGCCTGTGTTCCACTCCAATACTCTGGAAAGAAAAACTCCCATTCAGATCCTGGGACAAG
AGCCTGATGCAGAGATGGTGGAATATCTCATC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC226319 representing NM_001113490
Red=Cloning site Green=Tags(s)

MRNSEEQPSGGTTVLQRLLQEQLRYGNPSENRSLLAIHQQATGNGPPFPSGSGNPGPQSDVLSPQDHHQQ
LVAHAARQEPQGQEIQSENLIMEKQLSPRMQNNEELPTYEEAKVQSQYFRGQQHASVGAAFYVTGVTNQK
MRTEGRPSVQRLNPGKMHQDEGLRDLKQGHVRSLSERLMQMSLATSGVKAHPPVTSAPLSPPQPNDLYKN
PTSSSEFYKAQGPLPNQHSLKGMEHRGPPPEYPFKGMPPQSVVCKPQEPGHFYSEHRLNQPGRTEGQLMR
YQHPPEYGAARPAQDISLPLSARNSQPHSPTSSLTSGGSLPLLQSPPSTRLSPARHPLVPNQGDHSAHLP
RPQQHFLPNQAHQGDHYRLSQPGLSQQQQQQQQQHHHHHHHQQQQQQQPQQQPGEAYSAMPRAQPSSASY
QPVPADPFAIVSRAQQMVEILSDENRNLRQELEGCYEKVARLQKVETEIQRVSEAYENLVKSSSKREALE
KAMRNKLEGEIRRMHDFNRDLRERLETANKQLAEKEYEGSEDTRKTISQLFAKNKESQREKEKLEAELAT
ARSTNEDQRRHIEIRDQALSNAQAKVVKLEEELKKKQVYVDKVEKMQQALVQLQAACEKREQLEHRLRTR
LERELESLRIQQRQGNCQPTNVSEYNAAALMELLREKEERILALEADMTKWEQKYLEENVMRHFALDAAA
TVAAQRDTTVISHSPNTSYDTALEARIQKEEEEILMANKRCLDMEGRIKTLHAQIIEKDAMIKVLQQRSR
KEPSKTEQLSCMRPAKSLMSISNAGSGLLSHSSTLTGSPIMEEKRDDKSWKGSLGILLGGDYRAEYVPST
PSPVPPSTPLLSAHSKTGSRDCSTQTERGTESNKTAAVAPISVPAPVAAAATAAAITATAATITTTMVAA
APVAVAAAAAPAAAAAPSPATAAATAAAVSPAAAGQIPAAASVASAAAVAPSAAAAAAVQVAPAAPAPVP
APALVPVPAPAAAQASAPAQTQAPTSAPAVAPTPAPTPTPAVAQAEVPASPATGPGPHRLSIPSLTCNPD
KTDGPVFHSNTLERKTPIQILGQEPDAEMVEYLI

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_001113490
ORF Size 3252 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_001113490.1, NP_001106962
RefSeq ORF 3255
Locus ID 154796
Cytogenetics Xq23
MW 117.9 kDa
Gene Summary This gene belongs to the motin family of angiostatin binding proteins characterized by conserved coiled-coil domains and C-terminal PDZ binding motifs. The encoded protein is expressed predominantly in endothelial cells of capillaries as well as larger vessels of the placenta where it may mediate the inhibitory effect of angiostatin on tube formation and the migration of endothelial cells toward growth factors during the formation of new blood vessels. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (2)