ARMC5 (NM_001105247) Human Tagged ORF Clone

CAT#: RC226267

ARMC5 (Myc-DDK-tagged)-Human armadillo repeat containing 5 (ARMC5), transcript variant 1

Clone Modification / Custom Cloning Service

USD 1,422.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name ARMC5 (NM_001105247) Human Tagged ORF Clone
Symbol ARMC5
Synonyms AIMAH2; AIMAH2
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC226267 representing NM_001105247
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGGCTGCGAAGCCAACCCTCACGGACTCGCTCTCGTTCTGCCTCGCGCAGCTCGCGGCGGCGGCCG
GGGAGGCTCTGGGTGGGGAAAAGGACCCAGCGACCAACGAGACACCCCTGAGCCGCGCGCTCCTAGCCCT
CCGCACGCGCCACATCAAGGCAGCGGGGGGAATCGAGCGCTTCCGGGCACGCGGCGGGCTCCGCCCCCTA
CTCGCGCTGCTACGGCGAGCGGCTGCAGCGGGTTCCGCCCCGTCCCAGGCAGGCCCCGGCTCCGCCCCCT
CGTCGGCCGCGTCGGGAGCTTCTAGCCCCGCCCCCGCGTCGGGCCCCGCCCCCTCCGCTGTGTCGTCGTC
TAGTCCTACGCCGCCAGTGCGCCTGCGCAAGACGCTGGACTTGGCGCTCAGCATCCTAGCCGATTGCTGT
ACGGAAGGGGCGTGCCGGACCGAAGTGCGCAGACTCGGAGGCATACTCCCTTTGGTGACCATTCTTCAGT
GCATGAAGACAGACAGCATCCAGAACCGAACGGCCCGTGCCCTGGGGAACTTAGCCATGGAACCTGAGAG
CTGTGGGGACATCCACTGTGCTGGTGCTGTTCCCCTGCTTGTGGAGAGCCTGACAGCCTGCCAGGACTCG
CAGTGCCTACAGAGCGTGGTGCGTGCCCTCCGTAACCTGGCAGACTCACCCCAGCACCGCCTGGCCTTGG
CACAGCAGGGAGCAGTGCGTCCGCTGGCCGAGCTCCTGGCCACTGCCCCAGATGCTGCACTGACCTTAGC
CCTCGTCCGTGCCCTCCTGGAACTCAGCCGAGGCTGCTCCCGGGCCTGTGCTGAGCAGCTAAGTCTGGGT
GGGGGATTGGGCCCACTCGTCAGCCTGGCTTCCCACCCCAAGCGGGCAGTACGCGAGGGAACCATTCTGA
TCCTCGCCAACCTGTGTGCCCAGGGCCTGATTCGGCCTGCACTGGGCAATGCTGGTGGCGTGGAGGTGCT
GGTAGATGAGCTCCGGCAGCGCCGGGATCCTAATGGAGCTAGCCCAACCTCCCAGCAGCCCCTGGTGCGG
GCTGTGTGCCTCCTATGTCGTGAGGCCATCAACCGGGCCCGACTGCGGGATGCTGGTGGCTTGGATCTAC
TGATGGGCCTGCTGCGGGACCCTCGTGCAAGCGCATGGCACCCTCGTATTGTGGCTGCCCTTGTGGGGTT
TCTGTATGACACTGGGGCCCTGGGCCGGCTGCAGGCTCTGGGACTTGTGCCTCTCCTGGCTGGGCAGCTG
TGTGGTGAGGCTGGTGAGGAGGAAGAAGAGGGAAGAGAAGCTGCTTCCTGGGACTTTCCTGAGGAGAGGA
CCCCTGAGCGGGCACAGGGTGGAAGCTTCCGGAGCCTCAGGTCGTGGCTGATCTCCGAGGGCTATGCCAC
AGGCCCTGATGACATCTCCCCCGACTGGTCTCCTGAGCAGTGTCCGCCGGAGCCCATGGAGCCGGCCAGC
CCCGCCCCGACCCCGACCTCGCTGCGGGCACCACGCACCCAACGCACTCCGGGCCGCAGCCCCGCCGCCG
CCATCGAGGAGCCTTGGGGACGCGAAGGGCCAGCCCTGCTGCTGCTGTCGCGCTTTTCCCAGGCCCCTGA
CCCAAGTGGGGCACTTGTGACCGGCCCGGCGCTGTACGGCCTGCTGACCTATGTGACCGGCGCACCGGGC
CCGCCCAGCCCACGTGCACTGCGCATTCTGTCACGCCTCACCTGCAACCCTGCCTGCCTCGAGGCCTTCG
TGCGCAGCTATGGCGCGGCGCTGCTGCGGGCCTGGCTGGTGCTGGGGGTGGCGCCTGACGATTGGCCGGC
ACCACGTGCCCGGCCCACTCTCCACAGCCGGCACCGAGAGCTGGGGGAGAGGCTACTGCAGAACCTGACG
GTTCAGGCTGAGTCGCCCTTTGGGGTTGGGGCCCTGACGCACCTGCTGCTCTCTGGGAGCCCTGAGGACC
GAGTGGCCTGCGCGCTGACCCTGCCCTTCATCTGCCGGAAGCCCTCTCTGTGGCGCCGGCTGCTTCTGGA
GCAGGGTGGTCTCCGGCTCCTCCTTGCGGCGCTGACCCGGCCGGCCCCACACCCGCTCTTCCTCTTCTTT
GCCGCGGACTCCCTTTCCTGCCTCCAAGACCTGGTGTCTCCCACTGTGAGCCCAGCTGTCCCACAGGCAG
TCCCCATGGACCTAGACTCACCTTCCCCTTGCCTCTATGAACCTCTGCTGGGCCCAGCCCCTGTCCCAGC
TCCCGACCTGCACTTCCTGCTGGACTCAGGCCTCCAGCTCCCTGCCCAGCGAGCGGCCTCAGCCACCGCC
TCCCCTTTCTTCCGGGCCCTGCTGTCAGGCAGCTTTGCAGAAGCCCAGATGGACCTGGTGCCCCTGCGAG
GTCTGTCGCCTGGTGCAGCCTGGCCTGTCCTGCATCATTTGCATGGTTGTCGGGGGTGTGGGGCTGCCCT
GGGGCCCGTGCCCCCACCAGGCCAGCCCCTGCTGGGTTCAGAGGCCGAGGAGGCACTGGAGGCTGCTGGC
CGTTTCCTACTGCCTGGGCTGGAGGAGGAGCTGGAAGAGGCCGTGGGCCGCATCCACCTGGGACCCCAGG
GTGGCCCGGAGTCAGTGGGTGAGGTGTTCCGCCTGGGCCGGCCCCGGCTGGCTGCCCACTGTGCCCGCTG
GACACTGGGGTCAGAGCAGTGCCCGAGGAAGCGGGGTCTGGCCCTGGTGGGGCTTGTGGAGGCAGCAGGT
GAAGAGGCAGGGCCCCTGACGGAGGCTTTGCTGGCTGTGGTGATGGGGATTGAGTTGGGGGCAAGGGTCC
CTGCC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC226267 representing NM_001105247
Red=Cloning site Green=Tags(s)

MAAAKPTLTDSLSFCLAQLAAAAGEALGGEKDPATNETPLSRALLALRTRHIKAAGGIERFRARGGLRPL
LALLRRAAAAGSAPSQAGPGSAPSSAASGASSPAPASGPAPSAVSSSSPTPPVRLRKTLDLALSILADCC
TEGACRTEVRRLGGILPLVTILQCMKTDSIQNRTARALGNLAMEPESCGDIHCAGAVPLLVESLTACQDS
QCLQSVVRALRNLADSPQHRLALAQQGAVRPLAELLATAPDAALTLALVRALLELSRGCSRACAEQLSLG
GGLGPLVSLASHPKRAVREGTILILANLCAQGLIRPALGNAGGVEVLVDELRQRRDPNGASPTSQQPLVR
AVCLLCREAINRARLRDAGGLDLLMGLLRDPRASAWHPRIVAALVGFLYDTGALGRLQALGLVPLLAGQL
CGEAGEEEEEGREAASWDFPEERTPERAQGGSFRSLRSWLISEGYATGPDDISPDWSPEQCPPEPMEPAS
PAPTPTSLRAPRTQRTPGRSPAAAIEEPWGREGPALLLLSRFSQAPDPSGALVTGPALYGLLTYVTGAPG
PPSPRALRILSRLTCNPACLEAFVRSYGAALLRAWLVLGVAPDDWPAPRARPTLHSRHRELGERLLQNLT
VQAESPFGVGALTHLLLSGSPEDRVACALTLPFICRKPSLWRRLLLEQGGLRLLLAALTRPAPHPLFLFF
AADSLSCLQDLVSPTVSPAVPQAVPMDLDSPSPCLYEPLLGPAPVPAPDLHFLLDSGLQLPAQRAASATA
SPFFRALLSGSFAEAQMDLVPLRGLSPGAAWPVLHHLHGCRGCGAALGPVPPPGQPLLGSEAEEALEAAG
RFLLPGLEEELEEAVGRIHLGPQGGPESVGEVFRLGRPRLAAHCARWTLGSEQCPRKRGLALVGLVEAAG
EEAGPLTEALLAVVMGIELGARVPA

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_001105247
ORF Size 2805 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_001105247.1, NP_001098717
RefSeq ORF 2808
Locus ID 79798
Cytogenetics 16p11.2
MW 97.5 kDa
Gene Summary This gene encodes a member of the ARM (armadillo/beta-catenin-like repeat) superfamily. The ARM repeat is a tandemly repeated sequence motif with approximately 40 amino acid long. This repeat is implicated in mediating protein-protein interactions. The encoded protein contains seven ARM repeats. Mutations in this gene are associated with primary bilateral macronodular adrenal hyperplasia, which is also known as ACTH-independent macronodular adrenal hyperplasia 2. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2014].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)