Angiopoietin 2(ANGPT2) (NM_001118888) Human Tagged ORF Clone

CAT#: RC225727

ANGPT2 (Myc-DDK-tagged)-Human angiopoietin 2 (ANGPT2), transcript variant 3

Need custom modification / cloning service?
Get a free quote

USD 577.00


Availability*
In Stock

Size
    • 10 ug

Cited in 1 publication.

Product images

Specifications

Product Data
Product Name Angiopoietin 2(ANGPT2) (NM_001118888) Human Tagged ORF Clone
Symbol ANGPT2
Synonyms AGPT2; ANG2
Vector pCMV6-Entry
Sequence Data
>RC225727 representing NM_001118888
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTGGCAGATTGTTTTCTTTACTCTGAGCTGTGATCTTGTCTTGGCCGCAGCCTATAACAACTTTCGGA
AGAGCATGGACAGCATAGGAAAGAAGCAATATCAGGTCCAGCATGGGTCCTGCAGCTACACTTTCCTCCT
GCCAGAGATGGACAACTGCCGCTCTTCCTCCAGCCCCTACGTGTCCAATGCTGTGCAGAGGGACGCGCCG
CTCGAATACGATGACTCGGTGCAGAGGCTGCAAGTGCTGGAGAACATCATGGAAAACAACACTCAGTGGC
TAATGAAGGTATTAAATCAGACCACGAGACTTGAACTTCAGCTCTTGGAACACTCCCTCTCGACAAACAA
ATTGGAAAAACAGATTTTGGACCAGACCAGTGAAATAAACAAATTGCAAGATAAGAACAGTTTCCTAGAA
AAGAAGGTGCTAGCTATGGAAGACAAGCACATCATCCAACTACAGTCAATAAAAGAAGAGAAAGATCAGC
TACAGGTGTTAGTATCCAAGCAAAATTCCATCATTGAAGAACTAGAAAAAAAAATAGTGACTGCCACGGT
GAATAATTCAGTTCTTCAGAAGCAGCAACATGATCTCATGGAGACAGTTAATAACTTACTGACTATGATG
TCCACATCAAACTCAGCTAAGGACCCCACTGTTGCTAAAGAAGAACAAATCAGCTTCAGAGACTGTGCTG
AAGTATTCAAATCAGGACACACCACGAATGGCATCTACACGTTAACATTCCCTAATTCTACAGAAGAGAT
CAAGGCCTACTGTGACATGGAAGCTGGAGGAGGCGGGTGGACAATTATTCAGCGACGTGAGGATGGCAGC
GTTGATTTTCAGAGGACTTGGAAAGAATATAAAGTGGGATTTGGTAACCCTTCAGGAGAATATTGGCTGG
GAAATGAGTTTGTTTCGCAACTGACTAATCAGCAACGCTATGTGCTTAAAATACACCTTAAAGACTGGGA
AGGGAATGAGGCTTACTCATTGTATGAACATTTCTATCTCTCAAGTGAAGAACTCAATTATAGGATTCAC
CTTAAAGGACTTACAGGGACAGCCGGCAAAATAAGCAGCATCAGCCAACCAGGAAATGATTTTAGCACAA
AGGATGGAGACAACGACAAATGTATTTGCAAATGTTCACAAATGCTAACAGGAGGCTGGTGGTTTGATGC
ATGTGGTCCTTCCAACTTGAACGGAATGTACTATCCACAGAGGCAGAACACAAATAAGTTCAACGGCATT
AAATGGTACTACTGGAAAGGCTCAGGCTATTCGCTCAAGGCCACAACCATGATGATCCGACCAGCAGATT
TC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC225727 representing NM_001118888
Red=Cloning site Green=Tags(s)

MWQIVFFTLSCDLVLAAAYNNFRKSMDSIGKKQYQVQHGSCSYTFLLPEMDNCRSSSSPYVSNAVQRDAP
LEYDDSVQRLQVLENIMENNTQWLMKVLNQTTRLELQLLEHSLSTNKLEKQILDQTSEINKLQDKNSFLE
KKVLAMEDKHIIQLQSIKEEKDQLQVLVSKQNSIIEELEKKIVTATVNNSVLQKQQHDLMETVNNLLTMM
STSNSAKDPTVAKEEQISFRDCAEVFKSGHTTNGIYTLTFPNSTEEIKAYCDMEAGGGGWTIIQRREDGS
VDFQRTWKEYKVGFGNPSGEYWLGNEFVSQLTNQQRYVLKIHLKDWEGNEAYSLYEHFYLSSEELNYRIH
LKGLTGTAGKISSISQPGNDFSTKDGDNDKCICKCSQMLTGGWWFDACGPSNLNGMYYPQRQNTNKFNGI
KWYYWKGSGYSLKATTMMIRPADF

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_001118888
ORF Size 1332 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_001118888.1, NP_001112360
RefSeq ORF 1335
Locus ID 285
Cytogenetics 8p23.1
Protein Families Secreted Protein, Druggable Genome
MW 50.96 kDa
Gene Summary The protein encoded by this gene is an antagonist of angiopoietin 1 (ANGPT1) and endothelial TEK tyrosine kinase (TIE-2, TEK). The encoded protein disrupts the vascular remodeling ability of ANGPT1 and may induce endothelial cell apoptosis. Three transcript variants encoding three different isoforms have been found for this gene. [provided by RefSeq, Jul 2008].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)