ABCB8 (NM_007188) Human Tagged ORF Clone

CAT#: RC224948

ABCB8 (Myc-DDK-tagged)-Human ATP-binding cassette, sub-family B (MDR/TAP), member 8 (ABCB8), nuclear gene encoding mitochondrial protein

Clone Modification / Custom Cloning Service

  • TrueORF®

USD 577.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name ABCB8 (NM_007188) Human Tagged ORF Clone
Symbol ABCB8
Synonyms EST328128; M-ABC1; MABC1
Vector pCMV6-Entry
Sequence Data
>RC224948 representing NM_007188
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCTGGTGCATTTATTTCGGGTCGGGATTCGGGGTGGCCCATTCCCAGGCAGGCTGCTACCGCCCCTCC
GCTTCCAGACATTCTCAGCTGTCAGGTACTCTGATGGCTACCGCAGCTCCTCCCTCCTCCGGGCCGTGGC
CCACCTGCGGTCCCAGCTCTGGGCCCACCTCCCTCGAGCCCCCCTAGCTCCCAGATGGAGCCCCTCTGCC
TGGTGCTGGGTTGGGGGAGCCCTGCTAGGCCCCATGGTACTGAGTAAGCATCCCCACCTCTGCCTTGTGG
CCCTGTGTGAGGCAGAAGAGGCCCCTCCTGCCAGCTCCACACCCCATGTCGTGGGGTCTCGCTTTAACTG
GAAGCTCTTCTGGCAGTTTCTGCACCCCCACCTGCTGGTCCTGGGGGTAGCCGTCGTGCTGGCCTTGGGT
GCGGCACTCGTGAATGTACAGATCCCCCTGCTCCTGGGCCAGCTGGTAAAGGTCGTGGCCAAGTACACAA
GGGACCACGTAGGGAGTTTCATGACTGAGTCCCAGAATCTCAGCACCCACCTGCTTATCCTCTATGGTGT
CCAGGGACTGCTGACCTTCGGGTACCTGGTGCTGCTGTCCCACGTTGGCGAGCGCATGGCTGTGGACATG
CGGAGGGCCCTCTTCAGCTCCCTGCTCCGACAAAACATCACCTTCTTTGACGCCAATAAGACAGGGCAGC
TGGTGAGCCGCTTGACAACTGACGTGCAGGAATTTAAGTCATCCTTCAAGCTTGTCATCTCCCAGGGGCT
GCGAAGCTGCTCCCAGGTGGCAGGCTGCCTGGTGTCCCTGTCCATGCTGTCGACACGCCTCACGCTGCTG
CTGATGGTGGCCACACCAGCCCTGATGGGAGTGGGCACCCTGATGGGCTCAGGCCTCCGAAAATTGTCTC
GCCAGTGTCAGGAACATATCGCCAGGGCAATGGGCGTAGCAGACGAGGCCCTGGGCAATGTGCGGACTGT
GCGAGCCTTGGCCATGGAGCAACGGGAAGAGGAGCGCTATGGGGCAGAGCTGGAAGCCTGCCGCTGCCGG
GCAGAGGAGCTGGGCCGCGGCATCGCCTTGTTCCAAGGGCTTTCCAACATCGCCTTCAACTGCATGGTCT
TGGGTACCCTATTTATTGGGGGCTCCCTTGTGGCCGGACAGCAGCTGACAGGGGGAGACCTCATGTCCTT
CCTGGTGGCCTCCCAGACAGTGCAAAGGTCCATGGCCAACCTCTCTGTCCTGTTTGGGCAGGTGGTCCGG
GGGCTGAGTGCAGGTGCCCGGGTCTTTGAGTACATGGCCCTGAACCCCTGCATCCCACTGTCTGGGGGCT
GCTGCGTCCCCAAAGAGCAGCTGCGTGGCTCCGTTACATTTCAGAACGTCTGCTTCAGCTACCCCTGCCG
CCCCGGCTTCGAGGTGCTGAAAGACTTCACCCTGACGCTGCCCCCTGGCAAGATCGTGGCCCTCGTGGGC
CAGTCTGGCGGAGGAAAGACCACCGTGGCTTCCCTGCTGGAGCGCTTCTACGACCCCACGGCAGGCGTGG
TGATGCTGGATGGGCGGGACCTGCGCACCCTTGACCCCTCCTGGCTCCGGGGCCAGGTTGTCGGTTTCAT
CAGCCAGGAGCCCGTCCTGTTTGGGACGACCATCATGGAAAACATCCGCTTTGGGAAGCTGGAAGCTTCC
GATGAAGAGGTGTACACAGCCGCCCGGGAAGCGAATGCTCACGAGTTCATCACCAGTTTCCCCGAGGGCT
ACAACACGGTCGTCGGTGAACGGGGCACTACCCTGTCTGGGGGCCAGAAGCAGCGCCTGGCCATCGCCCG
AGCCCTTATCAAGCAGCCCACGGTGCTGATACTGGATGAAGCTACCAGCGCGCTGGATGCAGAGTCCGAG
CGGGTTGTACAGGAGGCCCTGGACCGGGCCAGTGCAGGCCGCACGGTGCTGGTAATTGCCCACCGGCTCA
GCACTGTCCGTGGGGCCCACTGCATTGTCGTCATGGCCGATGGCCGTGTCTGGGAGGCTGGGACACATGA
AGAGCTCCTGAAGAAAGGCGGGCTATACGCCGAGCTCATCCGGAGGCAGGCCCTGGATGCCCCGAGGACA
GCGGCCCCACCGCCCAAAAAGCCAGAAGGCCCCAGGAGCCACCAGCACAAGTCC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC224948 representing NM_007188
Red=Cloning site Green=Tags(s)

MLVHLFRVGIRGGPFPGRLLPPLRFQTFSAVRYSDGYRSSSLLRAVAHLRSQLWAHLPRAPLAPRWSPSA
WCWVGGALLGPMVLSKHPHLCLVALCEAEEAPPASSTPHVVGSRFNWKLFWQFLHPHLLVLGVAVVLALG
AALVNVQIPLLLGQLVKVVAKYTRDHVGSFMTESQNLSTHLLILYGVQGLLTFGYLVLLSHVGERMAVDM
RRALFSSLLRQNITFFDANKTGQLVSRLTTDVQEFKSSFKLVISQGLRSCSQVAGCLVSLSMLSTRLTLL
LMVATPALMGVGTLMGSGLRKLSRQCQEHIARAMGVADEALGNVRTVRALAMEQREEERYGAELEACRCR
AEELGRGIALFQGLSNIAFNCMVLGTLFIGGSLVAGQQLTGGDLMSFLVASQTVQRSMANLSVLFGQVVR
GLSAGARVFEYMALNPCIPLSGGCCVPKEQLRGSVTFQNVCFSYPCRPGFEVLKDFTLTLPPGKIVALVG
QSGGGKTTVASLLERFYDPTAGVVMLDGRDLRTLDPSWLRGQVVGFISQEPVLFGTTIMENIRFGKLEAS
DEEVYTAAREANAHEFITSFPEGYNTVVGERGTTLSGGQKQRLAIARALIKQPTVLILDEATSALDAESE
RVVQEALDRASAGRTVLVIAHRLSTVRGAHCIVVMADGRVWEAGTHEELLKKGGLYAELIRRQALDAPRT
AAPPPKKPEGPRSHQHKS

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_007188
ORF Size 2154 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_007188.1, NM_007188.2, NM_007188.3, NM_007188.4, NP_009119
RefSeq Size 2439
RefSeq ORF 2157
Locus ID 11194
Cytogenetics 7q36.1
Domains ABC_membrane, ABC_tran, AAA
Protein Families Transmembrane, Druggable Genome
Protein Pathways ABC transporters
MW 77.9 kDa
Gene Summary This nuclear gene encodes a multi-pass membrane protein that is targeted to the mitochondrial inner membrane. The encoded protein is an ATP-dependent transporter that may mediate the passage of organic and inorganic molecules out of the mitochondria. Loss of function of the related gene in mouse results in a disruption of iron homeostasis between the mitochondria and cytosol. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2013]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)