NeuN (RBFOX3) (NM_001082575) Human Tagged ORF Clone

CAT#: RC224826

RBFOX3 (Myc-DDK-tagged)-Human RNA binding protein, fox-1 homolog (C. elegans) 3 (RBFOX3)

ORF Plasmid: DDK tGFP

Lentiviral Particles: DDK DDK w/ Puro mGFP mGFP w/ Puro


  "NM_001082575" in other vectors (6)

Reconstitution Protocol

USD 450.00

In Stock*

Size
    • 10 ug

Product Images

Frequently bought together (4)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

USD 198.00


RBFOX3 mouse monoclonal antibody,clone OTI2E5
    • 100 ul

USD 447.00

Other products for "NeuN"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol NeuN
Synonyms FOX-3; FOX3; HRNBP3; NEUN
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC224826 representing NM_001082575
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCCCAGCCCTACCCCCCCGCCCAGTACCCCCCTCCGCCACAGAACGGCATCCCTGCCGAGTACGCCC
CGCCCCCACCGCACCCCACGCAGGACTACTCCGGCCAGACCCCGGTCCCCACAGAGCATGGCATGACCCT
GTACACACCAGCACAGACCCACCCCGAGCAGCCAGGCTCCGAGGCCAGCACACAGCCCATCGCCGGGACC
CAGACAGTGCCGCAGACAGACGAGGCGGCACAGACGGACAGCCAGCCGCTCCACCCCTCCGACCCTACAG
AGAAGCAGCAGCCCAAGCGGCTACACGTCTCCAACATCCCCTTCCGGTTCAGGGACCCCGACTTGCGGCA
AATGTTCGGGCAATTCGGAAAAATTTTAGACGTGGAGATCATTTTTAACGAGCGGGGCTCCAAGGGTTTT
GGGTTTGTAACTTTTGAAACTAGCTCAGATGCTGACCGAGCCCGGGAGAAGCTGAATGGGACGATCGTAG
AGGGACGGAAAATTGAGGTCAATAATGCCACGGCCCGAGTGATGACCAACAAGAAGACGGGGAACCCCTA
CACCAACGGCTGGAAGCTAAATCCAGTGGTCGGCGCAGTCTACGGGCCTGAATTCTATGCAGTGACGGGG
TTCCCCTACCCCACCACCGGCACAGCCGTTGCCTACCGGGGCGCACATCTTCGGGGCCGGGGCCGGGCCG
TGTATAATACATTTCGGGCTGCGCCACCCCCACCCCCCATCCCGACTTACGGAGCGGTCGTGTATCAGGA
TGGATTTTATGGTGCTGAGATTTATGGAGGCTACGCAGCCTACAGATACGCTCAGCCCGCTGCAGCGGCG
GCAGCCTACAGCGACAGTTACGGCAGAGTCTACGCAGCTGCCGACCCGTACCATCACACCATCGGGCCCG
CGGCGACCTACAGCATTGGAACCATG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC224826 representing NM_001082575
Red=Cloning site Green=Tags(s)

MAQPYPPAQYPPPPQNGIPAEYAPPPPHPTQDYSGQTPVPTEHGMTLYTPAQTHPEQPGSEASTQPIAGT
QTVPQTDEAAQTDSQPLHPSDPTEKQQPKRLHVSNIPFRFRDPDLRQMFGQFGKILDVEIIFNERGSKGF
GFVTFETSSDADRAREKLNGTIVEGRKIEVNNATARVMTNKKTGNPYTNGWKLNPVVGAVYGPEFYAVTG
FPYPTTGTAVAYRGAHLRGRGRAVYNTFRAAPPPPPIPTYGAVVYQDGFYGAEIYGGYAAYRYAQPAAAA
AAYSDSYGRVYAAADPYHHTIGPAATYSIGTM

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_001082575
ORF Size 936 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_001082575.2
RefSeq Size 2696 bp
RefSeq ORF 939 bp
Locus ID 146713
UniProt ID A6NFN3
Cytogenetics 17q25.3
MW 33.7 kDa
Gene Summary This gene encodes a member of the RNA-binding FOX protein family which is involved in the regulation of alternative splicing of pre-mRNA. The protein has an N-terminal proline-rich region, an RNA recognition motif (RRM) domain, and a C-terminal alanine-rich region. This gene produces the neuronal nuclei (NeuN) antigen that has been widely used as a marker for post-mitotic neurons. This gene has its highest expression in the central nervous system and plays a prominent role in neural tissue development and regulation of adult brain function. Mutations in this gene have been associated with numerous neurological disorders. Alternative splicing of this gene results in multiple transcript variants encoding distinct isoforms. [provided by RefSeq, May 2017]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.