GDF10 (NM_004962) Human Tagged ORF Clone

CAT#: RC224791

GDF10 (Myc-DDK-tagged)-Human growth differentiation factor 10 (GDF10)

Change vector?

  • TrueORF®

USD 618


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name GDF10 (NM_004962) Human Tagged ORF Clone
Symbol GDF10
Synonyms BIP; BMP-3b; BMP3B
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC224791 representing NM_004962
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCTCATGTCCCCGCTCGGACCAGCCCGGGACCCGGGCCCCAGCTGCTGCTGCTGCTGCTGCCGTTGT
TTCTGCTGTTGCTCCGGGATGTGGCCGGCAGCCACAGGGCCCCCGCCTGGTCCGCACTGCCCGCGGCCGC
CGACGGCCTGCAGGGGGACAGGGATCTCCAGCGGCACCCTGGGGACGCGGCCGCCACGTTGGGCCCCAGC
GCCCAGGACATGGTCGCTGTCCACATGCACAGGCTCTATGAGAAGTACAGCCGGCAGGGCGCGCGGCCGG
GAGGGGGCAACACGGTCCGCAGCTTCAGGGCCAGGCTGGAAGTGGTCGACCAGAAGGCCGTGTATTTCTT
CAACCTGACTTCCATGCAAGACTCGGAAATGATCCTTACGGCCACTTTCCACTTCTACTCAGAGCCGCCT
CGGTGGCCTCGAGCGCTCGAGGTGCTATGCAAGCCGCGGGCCAAGAACGCTTCAGGCCGCCCGCTGCCCC
TGGGCCCGCCCACACGCCAGCACCTGCTCTTCCGCAGCCTCTCGCAGAACACGGCCACACAGGGGCTACT
CCGCGGGGCCATGGCCCTGGCGCCCCCACCGCGCGGCCTGTGGCAGGCCAAGGACATCTCCCCCATCGTC
AAGGCGGCCCGCCGGGATGGCGAGCTGCTCCTCTCCGCCCAGCTGGATTCTGAGGAGAGGGACCCGGGGG
TGCCCCGGCCCAGCCCCTATGCGCCCTACATCCTAGTCTATGCCAACGATCTGGCCATCTCGGAGCCCAA
CAGCGTGGCAGTGACGCTGCAGAGATACGACCCCTTCCCTGCCGGAGACCCCGAGCCCCGCGCAGCCCCC
AACAACTCAGCGGACCCCCGCGTGCGCCGAGCCGCGCAGGCCACTGGGCCCCTCCAGGACAACGAGCTGC
CGGGGCTGGATGAGAGGCCGCCGCGCGCCCACGCACAGCACTTCCACAAGCACCAGCTGTGGCCCAGCCC
CTTCCGGGCGCTGAAACCCCGGCCAGGGCGCAAAGACCGCAGGAAGAAGGGCCAGGAGGTGTTCATGGCC
GCCTCGCAGGTGCTGGACTTTGACGAGAAGACGATGCAGAAAGCCCGGAGGAAGCAGTGGGATGAGCCGA
GGGTGTGCTCCCGGAGGTACCTGAAGGTGGACTTCGCAGACATCGGCTGGAATGAATGGATAATCTCACC
GAAATCTTTTGATGCCTACTACTGCGCGGGAGCATGTGAGTTCCCCATGCCTAAGATCGTTCGTCCATCC
AACCATGCCACCATCCAGAGCATTGTCAGGGCTGTGGGCATCATCCCTGGCATCCCAGAGCCCTGCTGTG
TTCCCGATAAGATGAACTCCCTTGGGGTCCTCTTCCTGGATGAGAATCGGAATGTGGTTCTGAAGGTGTA
CCCCAACATGTCCGTGGACACCTGTGCCTGCCGG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC224791 representing NM_004962
Red=Cloning site Green=Tags(s)

MAHVPARTSPGPGPQLLLLLLPLFLLLLRDVAGSHRAPAWSALPAAADGLQGDRDLQRHPGDAAATLGPS
AQDMVAVHMHRLYEKYSRQGARPGGGNTVRSFRARLEVVDQKAVYFFNLTSMQDSEMILTATFHFYSEPP
RWPRALEVLCKPRAKNASGRPLPLGPPTRQHLLFRSLSQNTATQGLLRGAMALAPPPRGLWQAKDISPIV
KAARRDGELLLSAQLDSEERDPGVPRPSPYAPYILVYANDLAISEPNSVAVTLQRYDPFPAGDPEPRAAP
NNSADPRVRRAAQATGPLQDNELPGLDERPPRAHAQHFHKHQLWPSPFRALKPRPGRKDRRKKGQEVFMA
ASQVLDFDEKTMQKARRKQWDEPRVCSRRYLKVDFADIGWNEWIISPKSFDAYYCAGACEFPMPKIVRPS
NHATIQSIVRAVGIIPGIPEPCCVPDKMNSLGVLFLDENRNVVLKVYPNMSVDTCACR

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_004962
ORF Size 1434 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_004962.1, NM_004962.2, NM_004962.3, NM_004962.4, NP_004953
RefSeq Size 2674
RefSeq ORF 1437
Locus ID 2662
Cytogenetics 10q11.22
Protein Families Secreted Protein, Druggable Genome
MW 52.9 kDa
Gene Summary This gene encodes a secreted ligand of the TGF-beta (transforming growth factor-beta) superfamily of proteins. Ligands of this family bind various TGF-beta receptors leading to recruitment and activation of SMAD family transcription factors that regulate gene expression. The encoded preproprotein is proteolytically processed to generate each subunit of the disulfide-linked homodimer. This promotes neural repair after stroke. Additionally, this protein may act as a tumor suppressor and reduced expression of this gene is associated with oral cancer. [provided by RefSeq, Jul 2016].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations