CHD2 (NM_001271) Human Tagged ORF Clone

CAT#: RC224580

CHD2 (Myc-DDK-tagged)-Human chromodomain helicase DNA binding protein 2 (CHD2), transcript variant 1

  • TrueORF®

Need custom modification / cloning service?
Get a free quote

USD 1,999.00


Availability*
In Stock

Size
    • 10 ug

Cited in 1 publication.

Product images

Specifications

Product Data
Product Name CHD2 (NM_001271) Human Tagged ORF Clone
Symbol CHD2
Synonyms EEOC
Vector pCMV6-Entry
Sequence Data
>RC224580 representing NM_001271
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGATGAGAAATAAGGACAAAAGCCAAGAGGAGGACAGTTCGCTACACAGCAATGCATCGAGTCACTCAG
CCTCTGAAGAAGCTTCGGGTTCAGACTCAGGCAGTCAGTCGGAAAGTGAGCAGGGAAGTGATCCAGGAAG
TGGACATGGCAGCGAGTCGAACAGCAGCTCTGAATCTTCTGAGAGTCAGTCGGAATCTGAGAGCGAATCA
GCAGGTTCCAAATCCCAGCCAGTCCTCCCAGAAGCCAAAGAGAAGCCAGCCTCTAAGAACGAACGGATAG
CTGATGTGAAGAAGATGTGGGAAGAATATCCTGATGTTTATGGGGTCAGGCGGTCAAACCGAAGCAGACA
AGAACCATCGCGATTTAATATTAAGGAAGAGGCAAGTAGCGGGTCTGAGAGTGGGAGCCCAAAAAGAAGA
GGCCAGAGGCAGCTGAAAAAACAAGAAAAATGGAAACAGGAACCCTCAGAAGATGAACAGGAACAAGGCA
CCAGTGCAGAGAGTGAGCCAGAACAAAAAAAAGTAAAAGCCAGAAGACCTGTCCCCAGAAGAACAGTGCC
CAAACCTCGTGTTAAAAAGCAGCCGAAGACTCAGCGTGGAAAGAGAAAAAAGCAAGATTCTTCTGATGAG
GATGATGATGATGACGAAGCTCCCAAAAGGCAGACTCGTCGAAGAGCGGCTAAAAACGTTAGTTACAAAG
AAGATGATGACTTTGAGACTGACTCAGATGATCTCATTGAAATGACTGGAGAAGGAGTTGATGAACAGCA
AGATAATAGTGAAACTATTGAAAAGGTCTTAGATTCAAGACTGGGAAAGAAAGGAGCCACTGGAGCATCT
ACTACTGTATATGCGATTGAAGCTAATGGCGACCCTAGTGGTGACTTTGACACTGAAAAGGATGAAGGTG
AAATCCAGTACCTCATCAAGTGGAAGGGTTGGTCTTACATCCACAGCACATGGGAGAGTGAAGAATCCTT
ACAGCAACAGAAAGTGAAGGGCCTAAAAAAACTAGAGAACTTCAAGAAAAAAGAGGACGAAATCAAACAA
TGGTTAGGGAAAGTTTCTCCTGAAGATGTAGAATATTTCAATTGCCAACAGGAGCTGGCTTCAGAGTTGA
ATAAACAGTATCAGATAGTAGAAAGAGTAATAGCTGTGAAGACAAGTAAATCTACATTGGGTCAAACAGA
TTTTCCAGCTCATAGTCGGAAGCCGGCACCCTCAAATGAGCCCGAATATCTATGTAAATGGATGGGACTC
CCCTATTCAGAGTGTAGCTGGGAAGATGAAGCCCTCATTGGAAAGAAATTCCAGAATTGCATTGACAGCT
TCCACAGTAGGAACAACTCAAAAACCATCCCAACAAGAGAATGCAAGGCCCTGAAGCAGAGACCACGATT
TGTAGCTTTAAAGAAACAACCTGCATATTTAGGAGGGGAGAATCTGGAACTTCGAGATTATCAGCTAGAA
GGTCTAAACTGGCTAGCTCATTCCTGGTGCAAAAATAATAGTGTAATCCTTGCTGATGAAATGGGCCTAG
GAAAGACCATCCAGACCATATCATTCCTCTCCTACCTGTTCCACCAACACCAGCTGTATGGCCCCTTTCT
TATAGTCGTCCCTTTATCCACCCTCACCTCATGGCAGAGAGAGTTTGAAATCTGGGCACCAGAGATTAAC
GTAGTGGTTTACATAGGTGACCTGATGAGCAGAAATACGATACGGGAATATGAATGGATTCATTCCCAAA
CCAAAAGATTGAAGTTCAACGCACTTATAACAACATATGAGATCCTCTTGAAAGATAAGACTGTGCTGGG
CAGTATTAACTGGGCCTTTCTGGGAGTGGATGAAGCCCATCGGTTGAAGAATGATGACTCTTTATTGTAT
AAAACTCTGATTGATTTCAAGTCCAACCATAGGCTCCTGATTACGGGGACCCCTCTTCAGAATTCCCTCA
AAGAGCTCTGGTCCTTGCTGCACTTTATTATGCCGGAGAAGTTTGAATTTTGGGAAGATTTTGAAGAAGA
CCATGGGAAGGGGAGAGAGAATGGCTACCAGAGTCTTCATAAGGTGCTAGAGCCTTTCCTTCTCCGGAGA
GTCAAAAAAGATGTGGAGAAATCCCTTCCTGCTAAAGTGGAACAGATTCTCAGGGTGGAGATGTCAGCCC
TTCAGAAACAGTATTACAAGTGGATTCTGACCAGGAATTACAAGGCTCTTGCCAAAGGAACAAGAGGCAG
CACATCTGGTTTTCTTAATATTGTGATGGAACTGAAAAAATGTTGCAACCACTGCTATCTGATTAAACCC
CCTGAAGAAAATGAAAGGGAAAATGGACAGGAGATTCTTCTGTCCCTCATAAGGAGCAGTGGGAAGTTGA
TTTTATTAGACAAACTGTTGACAAGACTTCGAGAAAGGGGGAATCGAGTGCTTATCTTCTCTCAGATGGT
GAGAATGTTGGATATCCTGGCTGAATACCTAACTATTAAACACTATCCTTTCCAGCGTCTGGATGGTTCC
ATCAAGGGAGAAATCCGAAAACAGGCACTGGACCACTTCAATGCAGATGGGTCTGAGGACTTCTGTTTCC
TGCTCTCGACAAGGGCTGGTGGCCTGGGAATCAATTTGGCTTCAGCGGACACAGTCGTCATCTTTGACTC
TGACTGGAACCCCCAGAATGACTTGCAGGCACAAGCCCGAGCGCATAGAATTGGTCAGAAGAAGCAGGTA
AATATTTACCGCTTAGTTACAAAGGGGACTGTGGAGGAGGAGATCATAGAACGGGCCAAAAAGAAGATGG
TATTAGATCATCTGGTGATTCAGCGCATGGACACCACTGGCCGGACGATCCTGGAAAACAACTCAGGAAG
GTCCAACTCAAATCCTTTTAATAAAGAAGAGCTGACAGCTATTTTGAAATTTGGAGCAGAGGATCTCTTC
AAAGAACTGGAAGGGGAGGAATCAGAACCTCAGGAAATGGATATAGATGAAATTTTGCGGTTGGCTGAAA
CGAGAGAGAATGAAGTGTCAACAAGTGCAACAGATGAACTTCTATCACAGTTTAAGGTTGCCAACTTTGC
AACAATGGAAGATGAAGAAGAGCTAGAAGAGCGTCCTCACAAGGACTGGGATGAGATCATTCCAGAGGAA
CAAAGGAAAAAAGTAGAGGAGGAAGAGCGGCAGAAGGAGCTAGAAGAAATTTATATGCTGCCTCGAATTC
GGAGTTCCACTAAAAAGGCTCAGACAAATGACAGTGACTCTGACACTGAGTCTAAGAGGCAGGCCCAGAG
ATCCTCTGCTTCTGAGAGTGAAACGGAAGACTCTGATGATGACAAGAAGCCAAAGCGCAGAGGGCGTCCG
AGGAGTGTGCGGAAGGACCTCGTGGAGGGATTTACTGATGCAGAGATCCGAAGGTTCATCAAGGCTTATA
AGAAGTTTGGTCTCCCTCTTGAACGGCTGGAGTGCATAGCACGTGATGCTGAGCTGGTAGATAAGTCGGT
GGCAGATCTGAAGCGCCTGGGTGAACTGATCCACAACAGCTGTGTGTCAGCAATGCAGGAATACGAAGAG
CAGCTGAAAGAAAATGCCAGCGAGGGAAAAGGACCAGGGAAAAGGAGAGGTCCAACAATCAAGATATCCG
GAGTTCAGGTTAATGTGAAATCCATTATCCAACATGAAGAGGAGTTTGAGATGCTGCATAAATCTATCCC
TGTGGACCCTGAAGAAAAAAAAAAATACTGCTTAACCTGTCGTGTCAAAGCTGCACATTTTGATGTAGAG
TGGGGGGTGGAAGATGATTCTCGCCTGTTGCTGGGGATTTATGAACATGGCTATGGAAACTGGGAGTTAA
TTAAAACAGACCCAGAGCTTAAATTAACTGACAAAATTCTGCCGGTGGAGACAGATAAAAAGCCTCAGGG
GAAGCAGCTACAGACCCGAGCGGATTACTTGTTGAAGCTGCTCAGAAAGGGTCTGGAGAAGAAGGGGGCT
GTGACAGGTGGGGAAGAGGCCAAATTAAAGAAGCGGAAGCCTCGGGTAAAGAAGGAAAACAAAGTGCCCA
GGCTGAAAGAGGAGCATGGAATTGAGCTTTCATCTCCTAGGCATTCAGATAATCCATCAGAAGAGGGAGA
AGTGAAAGATGATGGCTTGGAAAAAAGTCCAATGAAAAAAAAACAGAAGAAGAAAGAGAACAAGGAGAAC
AAGGAGAAACAAATGAGTTCTAGGAAAGACAAAGAAGGGGACAAGGAAAGAAAGAAGTCAAAAGATAAGA
AAGAGAAGCCTAAAAGTGGTGATGCCAAATCTTCGAGTAAATCAAAGCGATCTCAGGGTCCTGTCCATAT
TACAGCAGGAAGTGAACCTGTCCCCATTGGAGAGGATGAGGATGATGATCTGGACCAGGAGACATTCAGC
ATATGTAAGGAGAGGATGAGGCCCGTGAAAAAGGCACTGAAACAGCTCGACAAACCTGACAAGGGGCTCA
ACGTGCAAGAACAGCTGGAACACACCCGGAACTGCCTGCTGAAAATCGGAGACCGGATAGCCGAGTGCCT
TAAAGCCTACTCAGATCAGGAGCACATCAAACTCTGGAGGAGGAACCTATGGATTTTTGTTTCCAAGTTT
ACAGAATTTGATGCTCGAAAACTGCATAAGTTATACAAGATGGCTCATAAGAAAAGGTCTCAAGAAGAAG
AGGAGCAAAAGAAGAAAGACGACGTGACTGGGGGTAAGAAACCATTTCGTCCAGAGGCCTCAGGCTCCAG
CCGGGACTCTCTGATATCTCAGTCCCATACCTCACACAACCTTCACCCTCAGAAGCCTCATTTGCCTGCC
TCCCATGGCCCACAGATGCATGGACACCCAAGAGATAACTACAATCACCCCAACAAGAGACACTTCAGTA
ATGCAGATCGAGGAGACTGGCAGAGGGAAAGAAAGTTCAACTATGGTGGTGGCAACAACAATCCACCATG
GGGAAGCGACAGGCACCATCAGTATGAGCAGCACTGGTACAAGGACCACCATTATGGGGACCGGCGACAT
ATGGATGCCCACCGTTCCGGAAGCTATCGACCCAACAACATGTCCAGAAAGAGGCCTTATGACCAGTACA
GCAGTGACCGAGACCACCGGGGACACAGAGATTATTATGACAGGCACCATCATGACTCCAAGCGGAGGAG
ATCCGATGAATTTAGGCCTCAAAATTACCACCAGCAGGATTTCCGACGAATGTCTGATCACCGCCCCGCT
ATGGGCTACCATGGCCAGGGACCCTCAGACCATTACCGCTCTTTCCACACAGATAAACTGGGGGAATATA
AACAGCCTCTACCCCCATTGCACCCTGCAGTCTCAGATCCTCGCTCACCCCCTTCTCAGAAATCTCCTCA
CGATTCCAAGTCACCCCTGGATCATAGGTCTCCTTTGGAGAGATCACTAGAACAGAAAAACAACCCAGAT
TATAACTGGAATGTTCGGAAAACA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC224580 representing NM_001271
Red=Cloning site Green=Tags(s)

MMRNKDKSQEEDSSLHSNASSHSASEEASGSDSGSQSESEQGSDPGSGHGSESNSSSESSESQSESESES
AGSKSQPVLPEAKEKPASKNERIADVKKMWEEYPDVYGVRRSNRSRQEPSRFNIKEEASSGSESGSPKRR
GQRQLKKQEKWKQEPSEDEQEQGTSAESEPEQKKVKARRPVPRRTVPKPRVKKQPKTQRGKRKKQDSSDE
DDDDDEAPKRQTRRRAAKNVSYKEDDDFETDSDDLIEMTGEGVDEQQDNSETIEKVLDSRLGKKGATGAS
TTVYAIEANGDPSGDFDTEKDEGEIQYLIKWKGWSYIHSTWESEESLQQQKVKGLKKLENFKKKEDEIKQ
WLGKVSPEDVEYFNCQQELASELNKQYQIVERVIAVKTSKSTLGQTDFPAHSRKPAPSNEPEYLCKWMGL
PYSECSWEDEALIGKKFQNCIDSFHSRNNSKTIPTRECKALKQRPRFVALKKQPAYLGGENLELRDYQLE
GLNWLAHSWCKNNSVILADEMGLGKTIQTISFLSYLFHQHQLYGPFLIVVPLSTLTSWQREFEIWAPEIN
VVVYIGDLMSRNTIREYEWIHSQTKRLKFNALITTYEILLKDKTVLGSINWAFLGVDEAHRLKNDDSLLY
KTLIDFKSNHRLLITGTPLQNSLKELWSLLHFIMPEKFEFWEDFEEDHGKGRENGYQSLHKVLEPFLLRR
VKKDVEKSLPAKVEQILRVEMSALQKQYYKWILTRNYKALAKGTRGSTSGFLNIVMELKKCCNHCYLIKP
PEENERENGQEILLSLIRSSGKLILLDKLLTRLRERGNRVLIFSQMVRMLDILAEYLTIKHYPFQRLDGS
IKGEIRKQALDHFNADGSEDFCFLLSTRAGGLGINLASADTVVIFDSDWNPQNDLQAQARAHRIGQKKQV
NIYRLVTKGTVEEEIIERAKKKMVLDHLVIQRMDTTGRTILENNSGRSNSNPFNKEELTAILKFGAEDLF
KELEGEESEPQEMDIDEILRLAETRENEVSTSATDELLSQFKVANFATMEDEEELEERPHKDWDEIIPEE
QRKKVEEEERQKELEEIYMLPRIRSSTKKAQTNDSDSDTESKRQAQRSSASESETEDSDDDKKPKRRGRP
RSVRKDLVEGFTDAEIRRFIKAYKKFGLPLERLECIARDAELVDKSVADLKRLGELIHNSCVSAMQEYEE
QLKENASEGKGPGKRRGPTIKISGVQVNVKSIIQHEEEFEMLHKSIPVDPEEKKKYCLTCRVKAAHFDVE
WGVEDDSRLLLGIYEHGYGNWELIKTDPELKLTDKILPVETDKKPQGKQLQTRADYLLKLLRKGLEKKGA
VTGGEEAKLKKRKPRVKKENKVPRLKEEHGIELSSPRHSDNPSEEGEVKDDGLEKSPMKKKQKKKENKEN
KEKQMSSRKDKEGDKERKKSKDKKEKPKSGDAKSSSKSKRSQGPVHITAGSEPVPIGEDEDDDLDQETFS
ICKERMRPVKKALKQLDKPDKGLNVQEQLEHTRNCLLKIGDRIAECLKAYSDQEHIKLWRRNLWIFVSKF
TEFDARKLHKLYKMAHKKRSQEEEEQKKKDDVTGGKKPFRPEASGSSRDSLISQSHTSHNLHPQKPHLPA
SHGPQMHGHPRDNYNHPNKRHFSNADRGDWQRERKFNYGGGNNNPPWGSDRHHQYEQHWYKDHHYGDRRH
MDAHRSGSYRPNNMSRKRPYDQYSSDRDHRGHRDYYDRHHHDSKRRRSDEFRPQNYHQQDFRRMSDHRPA
MGYHGQGPSDHYRSFHTDKLGEYKQPLPPLHPAVSDPRSPPSQKSPHDSKSPLDHRSPLERSLEQKNNPD
YNWNVRKT

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_001271
ORF Size 5484 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_001271.3, NP_001262
RefSeq Size 9374
RefSeq ORF 5487
Locus ID 1106
Cytogenetics 15q26.1
Domains SNF2_N, chromo, DEXDc, helicase_C
Protein Families Transcription Factors
MW 211.2 kDa
Gene Summary The CHD family of proteins is characterized by the presence of chromo (chromatin organization modifier) domains and SNF2-related helicase/ATPase domains. CHD genes alter gene expression possibly by modification of chromatin structure thus altering access of the transcriptional apparatus to its chromosomal DNA template. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq, Jul 2008].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)