DCBLD2 (NM_080927) Human Tagged ORF Clone

CAT#: RC224483

DCBLD2 (Myc-DDK-tagged)-Human discoidin, CUB and LCCL domain containing 2 (DCBLD2)

Clone Modification / Custom Cloning Service

USD 1,185.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name DCBLD2 (NM_080927) Human Tagged ORF Clone
Symbol DCBLD2
Synonyms CLCP1; ESDN
Vector pCMV6-Entry
Sequence Data
>RC224483 representing NM_080927
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGAGCCGGGCGGTGGTGAGAGCCAGGCGCTGCCCGCAGTGTCCCCAAGTCCGGGCCGCGGCCGCCG
CCCCCGCCTGGGCCGCGCTCCCCCTCTCCCGCTCCCTCCCTCCCTGCTCCAACTCCTCCTCCTTCTCCAT
GCCTCTGTTCCTCCTGCTCTTACTTGTCCTGCTCCTGCTGCTCGAGGACGCTGGAGCCCAGCAAGGTGAT
GGATGTGGACACACTGTACTAGGCCCTGAGAGTGGAACCCTTACATCCATAAACTACCCACAGACCTATC
CCAACAGCACTGTTTGTGAATGGGAGATCCGTGTAAAGATGGGAGAGAGAGTTCGCATCAAATTTGGTGA
CTTTGACATTGAAGATTCTGATTCTTGTCACTTTAATTACTTGAGAATTTATAATGGAATTGGAGTCAGC
AGAACTGAAATAGGCAAATACTGTGGTCTGGGGTTGCAAATGAACCATTCAATTGAATCAAAAGGCAATG
AAATCACATTGCTGTTCATGAGTGGAATCCATGTTTCTGGACGCGGATTTTTGGCCTCATACTCTGTTAT
AGATAAACAAGATCTAATTACTTGTTTGGACACTGCATCCAATTTTTTGGAACCTGAGTTCAGTAAGTAC
TGCCCAGCTGGTTGTCTGCTTCCTTTTGCTGAGATATCTGGAACAATTCCTCATGGATATAGAGATTCCT
CGCCATTGTGCATGGCTGGTGTGCATGCAGGAGTAGTGTCAAACACGTTGGGCGGCCAAATCAGTGTTGT
AATTAGTAAAGGTATTCCCTATTATGAAAGTTCTTTGGCTAACAACGTCACATCTGTGGTGGGACACTTA
TCTACAAGTCTTTTTACATTTAAGACAAGTGGATGTTATGGAACACTGGGGATGGAGTCTGGTGTGATCG
CGGATCCTCAAATAACAGCATCATCTGTGCTGGAGTGGACTGACCACACAGGGCAAGAGAACAGTTGGAA
ACCCAAAAAAGCCAGGCTGAAAAAACCTGGACCGCCTTGGGCTGCTTTTGCCACTGATGAATACCAGTGG
TTACAAATAGATTTGAATAAGGAAAAGAAAATAACAGGCATTATAACCACTGGATCCACCATGGTGGAGC
ACAATTACTATGTGTCTGCCTACAGAATCCTGTACAGTGATGATGGGCAGAAATGGACTGTGTACAGAGA
GCCTGGTGTGGAGCAAGATAAGATATTTCAAGGAAACAAAGATTATCACCAGGATGTGCGTAATAACTTT
TTGCCACCAATTATTGCACGTTTTATTAGAGTGAATCCTACCCAATGGCAGCAGAAAATTGCCATGAAAA
TGGAGCTGCTCGGATGTCAGTTTATTCCTAAAGGTCGTCCTCCAAAACTTACTCAACCTCCACCTCCTCG
GAACAGCAATGACCTCAAAAACACTACAGCCCCTCCAAAAATAGCCAAAGGTCGTGCCCCAAAATTTACG
CAACCACTACAACCTCGCAGTAGCAATGAATTTCCTGCACAGACAGAACAAACAACTGCCAGTCCTGATA
TCAGAAATACTACCGTAACTCCAAATGTAACCAAAGATGTAGCGCTGGCTGCAGTTCTTGTCCCTGTGCT
GGTCATGGTCCTCACTACTCTCATTCTCATATTAGTGTGTGCTTGGCACTGGAGAAACAGAAAGAAAAAA
ACTGAAGGCACCTATGACTTACCTTACTGGGACCGGGCAGGTTGGTGGAAAGGAATGAAGCAGTTTCTTC
CTGCAAAAGCAGTGGACCATGAGGAAACCCCAGTTCGCTATAGCAGCAGCGAAGTTAATCACCTGAGTCC
AAGAGAAGTCACCACAGTGCTGCAGGCTGACTCTGCAGAGTATGCTCAGCCACTGGTAGGAGGAATTGTT
GGTACACTTCATCAAAGATCTACCTTTAAACCAGAAGAAGGAAAAGAAGCAGGCTATGCAGACCTAGATC
CTTACAACTCACCAGGGCAGGAAGTTTATCATGCCTATGCTGAACCACTCCCAATTACGGGGCCTGAGTA
TGCAACCCCAATCATCATGGACATGTCAGGGCACCCCACAACTTCAGTTGGTCAGCCCTCCACATCCACT
TTCAAGGCTACGGGGAACCAACCTCCCCCACTAGTGGGAACTTACAATACACTTCTCTCCAGGACTGACA
GCTGCTCCTCAGCCCAGGCCCAGTATGATACCCCGAAAGCTGGGAAGCCAGGTCTACCTGCCCCAGACGA
ATTGGTGTACCAGGTGCCACAGAGCACACAAGAAGTATCAGGAGCAGGAAGGGATGGGGAATGTGATGTT
TTTAAAGAAATCCTT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC224483 representing NM_080927
Red=Cloning site Green=Tags(s)

MASRAVVRARRCPQCPQVRAAAAAPAWAALPLSRSLPPCSNSSSFSMPLFLLLLLVLLLLLEDAGAQQGD
GCGHTVLGPESGTLTSINYPQTYPNSTVCEWEIRVKMGERVRIKFGDFDIEDSDSCHFNYLRIYNGIGVS
RTEIGKYCGLGLQMNHSIESKGNEITLLFMSGIHVSGRGFLASYSVIDKQDLITCLDTASNFLEPEFSKY
CPAGCLLPFAEISGTIPHGYRDSSPLCMAGVHAGVVSNTLGGQISVVISKGIPYYESSLANNVTSVVGHL
STSLFTFKTSGCYGTLGMESGVIADPQITASSVLEWTDHTGQENSWKPKKARLKKPGPPWAAFATDEYQW
LQIDLNKEKKITGIITTGSTMVEHNYYVSAYRILYSDDGQKWTVYREPGVEQDKIFQGNKDYHQDVRNNF
LPPIIARFIRVNPTQWQQKIAMKMELLGCQFIPKGRPPKLTQPPPPRNSNDLKNTTAPPKIAKGRAPKFT
QPLQPRSSNEFPAQTEQTTASPDIRNTTVTPNVTKDVALAAVLVPVLVMVLTTLILILVCAWHWRNRKKK
TEGTYDLPYWDRAGWWKGMKQFLPAKAVDHEETPVRYSSSEVNHLSPREVTTVLQADSAEYAQPLVGGIV
GTLHQRSTFKPEEGKEAGYADLDPYNSPGQEVYHAYAEPLPITGPEYATPIIMDMSGHPTTSVGQPSTST
FKATGNQPPPLVGTYNTLLSRTDSCSSAQAQYDTPKAGKPGLPAPDELVYQVPQSTQEVSGAGRDGECDV
FKEIL

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_080927
ORF Size 2325 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_080927.1, NM_080927.2, NM_080927.3, NP_563615
RefSeq Size 6093
RefSeq ORF 2328
Locus ID 131566
Cytogenetics 3q12.1|3
Domains F5_F8_type_C, CUB, LCCL
Protein Families Transmembrane, Druggable Genome
MW 84.9 kDa
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)