DPP9 (NM_139159) Human Tagged ORF Clone

CAT#: RC224465

DPP9 (Myc-DDK-tagged)-Human dipeptidyl-peptidase 9 (DPP9)

ORF Plasmid: DDK tGFP

Lentiviral Particles: DDK w/ Puro mGFP w/ Puro


  "NM_139159" in other vectors (5)

Reconstitution Protocol

USD 778.00

In Stock*

Size
    • 10 ug

Product Images

Frequently bought together (5)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

USD 198.00


DPP9 mouse monoclonal antibody, clone OTI2E3 (formerly 2E3)
    • 100 ul

USD 447.00

Other products for "DPP9"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol DPP9
Synonyms DP9; DPLP9; DPP IX; DPRP-2; DPRP2
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC224465 representing NM_139159
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCCACCACCGGGACCCCAACGGCCGACCGAGGCGACGCAGCCGCCACAGATGACCCGGCCGCCCGCT
TCCAGGTGCAGAAGCACTCGTGGGACGGGCTCCGGAGCATCATCCACGGCAGCCGCAAGTACTCGGGCCT
CATTGTCAACAAGGCGCCCCACGACTTCCAGTTTGTGCAGAAGACGGATGAGTCTGGGCCCCACTCCCAC
CGCCTCTACTACCTGGGAATGCCATATGGCAGCCGAGAGAACTCCCTCCTCTACTCTGAGATTCCCAAGA
AGGTCCGGAAAGAGGCTCTGCTGCTCCTGTCCTGGAAGCAGATGCTGGATCATTTCCAGGCCACGCCCCA
CCATGGGGTCTACTCTCGGGAGGAGGAGCTGCTGAGGGAGCGGAAACGCCTGGGGGTCTTCGGCATCACC
TCCTACGACTTCCACAGCGAGAGTGGCCTCTTCCTCTTCCAGGCCAGCAACAGCCTCTTCCACTGCCGCG
ACGGCGGCAAGAACGGCTTCATGGTGTCCCCTATGAAACCGCTGGAAATCAAGACCCAGTGCTCAGGGCC
CCGGATGGACCCCAAAATCTGCCCTGCCGACCCTGCCTTCTTCTCCTTCATCAATAACAGCGACCTGTGG
GTGGCCAACATCGAGACAGGCGAGGAGCGGCGGCTGACCTTCTGCCACCAAGGTTTATCCAATGTCCTGG
ATGACCCCAAGTCTGCGGGTGTGGCCACCTTCGTCATACAGGAAGAGTTCGACCGCTTCACTGGGTACTG
GTGGTGCCCCACAGCCTCCTGGGAAGGTTCAGAGGGCCTCAAGACGCTGCGAATCCTGTATGAGGAAGTC
GATGAGTCCGAGGTGGAGGTCATTCACGTCCCCTCTCCTGCGCTAGAAGAAAGGAAGACGGACTCGTATC
GGTACCCCAGGACAGGCAGCAAGAATCCCAAGATTGCCTTGAAACTGGCTGAGTTCCAGACTGACAGCCA
GGGCAAGATCGTCTCGACCCAGGAGAAGGAGCTGGTGCAGCCCTTCAGCTCGCTGTTCCCGAAGGTGGAG
TACATCGCCAGGGCCGGGTGGACCCGGGATGGCAAATACGCCTGGGCCATGTTCCTGGACCGGCCCCAGC
AGTGGCTCCAGCTCGTCCTCCTCCCCCCGGCCCTGTTCATCCCGAGCACAGAGAATGAGGAGCAGCGGCT
AGCCTCTGCCAGAGCTGTCCCCAGGAATGTCCAGCCGTATGTGGTGTACGAGGAGGTCACCAACGTCTGG
ATCAATGTTCATGACATCTTCTATCCCTTCCCCCAATCAGAGGGAGAGGACGAGCTCTGCTTTCTCCGCG
CCAATGAATGCAAGACCGGCTTCTGCCATTTGTACAAAGTCACCGCCGTTTTAAAATCCCAGGGCTACGA
TTGGAGTGAGCCCTTCAGCCCCGGGGAAGATGAATTTAAGTGCCCCATTAAGGAAGAGATTGCTCTGACC
AGCGGTGAATGGGAGGTTTTGGCGAGGCACGGCTCCAAGGGCACCAAGGACACGCCGCTGGAGCACCACC
TCTACGTGGTCAGCTATGAGGCGGCCGGCGAGATCGTACGCCTCACCACGCCCGGCTTCTCCCATAGCTG
CTCCATGAGCCAGAACTTCGACATGTTCGTCAGCCACTACAGCAGCGTGAGCACGCCGCCCTGCGTGCAC
GTCTACAAGCTGAGCGGCCCCGACGACGACCCCCTGCACAAGCAGCCCCGCTTCTGGGCTAGCATGATGG
AGGCAGCCAGCTGCCCCCCGGATTATGTTCCTCCAGAGATCTTCCATTTCCACACGCGCTCGGATGTGCG
GCTCTACGGCATGATCTACAAGCCCCACGCCTTGCAGCCAGGGAAGAAGCACCCCACCGTCCTCTTTGTA
TATGGAGGCCCCCAGGTGCAGCTGGTGAATAACTCCTTCAAAGGCATCAAGTACTTGCGGCTCAACACAC
TGGCCTCCCTGGGCTACGCCGTGGTTGTGATTGACGGCAGGGGCTCCTGTCAGCGAGGGCTTCGGTTCGA
AGGGGCCCTGAAAAACCAAATGGGCCAGGTGGAGATCGAGGACCAGGTGGAGGGCCTGCAGTTCGTGGCC
GAGAAGTATGGCTTCATCGACCTGAGCCGAGTTGCCATCCATGGCTGGTCCTACGGGGGCTTCCTCTCGC
TCATGGGGCTAATCCACAAGCCCCAGGTGTTCAAGGTGGCCATCGCGGGTGCCCCGGTCACCGTCTGGAT
GGCCTACGACACAGGGTACACTGAGCGCTACATGGACGTCCCTGAGAACAACCAGCACGGCTATGAGGCG
GGTTCCGTGGCCCTGCACGTGGAGAAGCTGCCCAATGAGCCCAACCGCTTGCTTATCCTCCACGGCTTCC
TGGACGAAAACGTGCACTTTTTCCACACAAACTTCCTCGTCTCCCAACTGATCCGAGCAGGGAAACCTTA
CCAGCTCCAGATCTACCCCAACGAGAGACACAGTATTCGCTGCCCCGAGTCGGGCGAGCACTATGAAGTC
ACGTTGCTGCACTTTCTACAGGAATACCTC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC224465 representing NM_139159
Red=Cloning site Green=Tags(s)

MATTGTPTADRGDAAATDDPAARFQVQKHSWDGLRSIIHGSRKYSGLIVNKAPHDFQFVQKTDESGPHSH
RLYYLGMPYGSRENSLLYSEIPKKVRKEALLLLSWKQMLDHFQATPHHGVYSREEELLRERKRLGVFGIT
SYDFHSESGLFLFQASNSLFHCRDGGKNGFMVSPMKPLEIKTQCSGPRMDPKICPADPAFFSFINNSDLW
VANIETGEERRLTFCHQGLSNVLDDPKSAGVATFVIQEEFDRFTGYWWCPTASWEGSEGLKTLRILYEEV
DESEVEVIHVPSPALEERKTDSYRYPRTGSKNPKIALKLAEFQTDSQGKIVSTQEKELVQPFSSLFPKVE
YIARAGWTRDGKYAWAMFLDRPQQWLQLVLLPPALFIPSTENEEQRLASARAVPRNVQPYVVYEEVTNVW
INVHDIFYPFPQSEGEDELCFLRANECKTGFCHLYKVTAVLKSQGYDWSEPFSPGEDEFKCPIKEEIALT
SGEWEVLARHGSKGTKDTPLEHHLYVVSYEAAGEIVRLTTPGFSHSCSMSQNFDMFVSHYSSVSTPPCVH
VYKLSGPDDDPLHKQPRFWASMMEAASCPPDYVPPEIFHFHTRSDVRLYGMIYKPHALQPGKKHPTVLFV
YGGPQVQLVNNSFKGIKYLRLNTLASLGYAVVVIDGRGSCQRGLRFEGALKNQMGQVEIEDQVEGLQFVA
EKYGFIDLSRVAIHGWSYGGFLSLMGLIHKPQVFKVAIAGAPVTVWMAYDTGYTERYMDVPENNQHGYEA
GSVALHVEKLPNEPNRLLILHGFLDENVHFFHTNFLVSQLIRAGKPYQLQIYPNERHSIRCPESGEHYEV
TLLHFLQEYL

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_139159
ORF Size 2550 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_139159.3, NP_631898.2
RefSeq Size 4274 bp
RefSeq ORF 2679 bp
Locus ID 91039
UniProt ID Q86TI2
Cytogenetics 19p13.3
Domains Peptidase_S9, DPPIV_N_term
Protein Families Druggable Genome, Protease
MW 96.4 kDa
Gene Summary This gene encodes a protein that is a member of the S9B family in clan SC of the serine proteases. The protein has been shown to have post-proline dipeptidyl aminopeptidase activity, cleaving Xaa-Pro dipeptides from the N-termini of proteins. Although the activity of this protein is similar to that of dipeptidyl peptidase 4 (DPP4), it does not appear to be membrane bound. In general, dipeptidyl peptidases appear to be involved in the regulation of the activity of their substrates and have been linked to a variety of diseases including type 2 diabetes, obesity and cancer. Several transcript variants of this gene have been described but not fully characterized. [provided by RefSeq, Jul 2008]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.