DKK2 (NM_014421) Human Tagged ORF Clone

CAT#: RC224432

DKK2 (Myc-DDK-tagged)-Human dickkopf homolog 2 (Xenopus laevis) (DKK2)

Need custom modification / cloning service?
Get a free quote

USD 402.00


Availability*
In Stock

Size
    • 10 ug

Cited in 3 publications.

Product images

Specifications

Product Data
Product Name DKK2 (NM_014421) Human Tagged ORF Clone
Symbol DKK2
Synonyms DKK-2; DKK-2
Vector pCMV6-Entry
Sequence Data
>RC224432 representing NM_014421
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCCGCGTTGATGCGGAGCAAGGATTCGTCCTGCTGCCTGCTCCTACTGGCCGCGGTGCTGATGGTGG
AGAGCTCACAGATCGGCAGTTCGCGGGCCAAACTCAACTCCATCAAGTCCTCTCTGGGCGGGGAGACGCC
TGGTCAGGCCGCCAATCGATCTGCGGGCATGTACCAAGGACTGGCATTCGGCGGCAGTAAGAAGGGCAAA
AACCTGGGGCAGGCCTACCCTTGTAGCAGTGATAAGGAGTGTGAAGTTGGGAGGTATTGCCACAGTCCCC
ACCAAGGATCATCGGCCTGCATGGTGTGTCGGAGAAAAAAGAAGCGCTGCCACCGAGATGGCATGTGCTG
CCCCAGTACCCGCTGCAATAATGGCATCTGTATCCCAGTTACTGAAAGCATCTTAACCCCTCACATCCCG
GCTCTGGATGGTACTCGGCACAGAGATCGAAACCACGGTCATTACTCAAACCATGACTTGGGATGGCAGA
ATCTAGGAAGACCACACACTAAGATGTCACATATAAAAGGGCATGAAGGAGACCCCTGCCTACGATCATC
AGACTGCATTGAAGGGTTTTGCTGTGCTCGTCATTTCTGGACCAAAATCTGCAAACCAGTGCTCCATCAG
GGGGAAGTCTGTACCAAACAACGCAAGAAGGGTTCTCATGGGCTGGAAATTTTCCAGCGTTGCGACTGTG
CGAAGGGCCTGTCTTGCAAAGTATGGAAAGATGCCACCTACTCCTCCAAAGCCAGACTCCATGTGTGTCA
GAAAATT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC224432 representing NM_014421
Red=Cloning site Green=Tags(s)

MAALMRSKDSSCCLLLLAAVLMVESSQIGSSRAKLNSIKSSLGGETPGQAANRSAGMYQGLAFGGSKKGK
NLGQAYPCSSDKECEVGRYCHSPHQGSSACMVCRRKKKRCHRDGMCCPSTRCNNGICIPVTESILTPHIP
ALDGTRHRDRNHGHYSNHDLGWQNLGRPHTKMSHIKGHEGDPCLRSSDCIEGFCCARHFWTKICKPVLHQ
GEVCTKQRKKGSHGLEIFQRCDCAKGLSCKVWKDATYSSKARLHVCQKI

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_014421
ORF Size 777 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_014421.1, NM_014421.2, NP_055236
RefSeq Size 3659
RefSeq ORF 780
Locus ID 27123
Cytogenetics 4q25
Protein Families Stem cell relevant signaling - Wnt Signaling pathway, Secreted Protein, ES Cell Differentiation/IPS, Adult stem cells, Cancer stem cells, Druggable Genome
Protein Pathways Wnt signaling pathway
MW 28.45 kDa
Gene Summary This gene encodes a protein that is a member of the dickkopf family. The secreted protein contains two cysteine rich regions and is involved in embryonic development through its interactions with the Wnt signaling pathway. It can act as either an agonist or antagonist of Wnt/beta-catenin signaling, depending on the cellular context and the presence of the co-factor kremen 2. Activity of this protein is also modulated by binding to the Wnt co-receptor LDL-receptor related protein 6 (LRP6). [provided by RefSeq, Jul 2008].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (3)