KGF (FGF7) (NM_002009) Human Tagged ORF Clone

CAT#: RC224418

FGF7 (Myc-DDK-tagged)-Human fibroblast growth factor 7 (FGF7)

Product Images

Circular map for RC224418

• 

  Western blot validation of overexpression lysate (Cat# LY400734) using anti-DDK antibody (Cat# TA50011-100). Left: Cell lysates from un-transfected HEK293T cells; Right: Cell lysates from HEK293T cells transfected with RC224418 using transfection reagent MegaTran 2.0 (Cat# TT210002).

• 

  Coomassie blue staining of purified FGF7 protein (Cat# TP324418). The protein was produced from HEK293T cells transfected with FGF7 cDNA clone (Cat# RC224418) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Type: Human Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: KGF
• Synonyms: HBGF-7; KGF
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >RC224418 representing NM_002009
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGCACAAATGGATACTGACATGGATCCTGCCAACTTTGCTCTACAGATCATGCTTTCACATTATCTGTC
  TAGTGGGTACTATATCTTTAGCTTGCAATGACATGACTCCAGAGCAAATGGCTACAAATGTGAACTGTTC
  CAGCCCTGAGCGACACACAAGAAGTTATGATTACATGGAAGGAGGGGATATAAGAGTGAGAAGACTCTTC
  TGTCGAACACAGTGGTACCTGAGGATCGATAAAAGAGGCAAAGTAAAAGGGACCCAAGAGATGAAGAATA
  ATTACAATATCATGGAAATCAGGACAGTGGCAGTTGGAATTGTGGCAATCAAAGGGGTGGAAAGTGAATT
  CTATCTTGCAATGAACAAGGAAGGAAAACTCTATGCAAAGAAAGAATGCAATGAAGATTGTAACTTCAAA
  GAACTAATTCTGGAAAACCATTACAACACATATGCATCAGCTAAATGGACACACAACGGAGGGGAAATGT
  TTGTTGCCTTAAATCAAAAGGGGATTCCTGTAAGAGGAAAAAAAACGAAGAAAGAACAAAAAACAGCCCA
  CTTTCTTCCTATGGCAATAACT
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >RC224418 representing NM_002009
  Red=Cloning site Green=Tags(s)
  
  MHKWILTWILPTLLYRSCFHIICLVGTISLACNDMTPEQMATNVNCSSPERHTRSYDYMEGGDIRVRRLF
  CRTQWYLRIDKRGKVKGTQEMKNNYNIMEIRTVAVGIVAIKGVESEFYLAMNKEGKLYAKKECNEDCNFK
  ELILENHYNTYASAKWTHNGGEMFVALNQKGIPVRGKKTKKEQKTAHFLPMAIT
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_002009
• ORF Size: 582 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_002009.4
• RefSeq Size: 3853 bp
• RefSeq ORF: 585 bp
• Locus ID: 2252
• UniProt ID: P21781
• Cytogenetics: 15q21.2
• Domains: FGF
• Protein Families: Adult stem cells, Druggable Genome, Embryonic stem cells, ES Cell Differentiation/IPS, Secreted Protein
• Protein Pathways: MAPK signaling pathway, Melanoma, Pathways in cancer, Regulation of actin cytoskeleton
• MW: 22.51 kDa
• Gene Summary: The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. This protein is a potent epithelial cell-specific growth factor, whose mitogenic activity is predominantly exhibited in keratinocytes but not in fibroblasts and endothelial cells. Studies of mouse and rat homologs of this gene implicated roles in morphogenesis of epithelium, reepithelialization of wounds, hair development and early lung organogenesis. [provided by RefSeq, Jul 2008]