PRMT1 (NM_001536) Human Tagged ORF Clone

CAT#: RC224239

PRMT1 (Myc-DDK-tagged)-Human protein arginine methyltransferase 1 (PRMT1), transcript variant 1

Clone Modification / Custom Cloning Service

USD 98.00

USD 460.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name PRMT1 (NM_001536) Human Tagged ORF Clone
Symbol PRMT1
Synonyms ANM1; HCP1; HRMT1L2; IR1B4
Vector pCMV6-Entry
Sequence Data
>RC224239 representing NM_001536
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGGCAGCCGAGGCCGCGAACTGCATCATGGAGAATTTTGTAGCCACCTTGGCTAATGGGATGAGCC
TCCAGCCGCCTCTTGAAGAAGTGTCCTGTGGCCAGGCGGAAAGCAGTGAGAAGCCCAACGCTGAGGACAT
GACATCCAAAGATTACTACTTTGACTCCTACGCACACTTTGGCATCCACGAGGAGATGCTGAAGGACGAG
GTGCGCACCCTCACTTACCGCAACTCCATGTTTCATAACCGGCACCTCTTCAAGGACAAGGTGGTGCTGG
ACGTCGGCTCGGGCACCGGCATCCTCTGCATGTTTGCTGCCAAGGCCGGGGCCCGCAAGGTCATCGGGAT
CGAGTGTTCCAGTATCTCTGATTATGCGGTGAAGATCGTCAAAGCCAACAAGTTAGACCACGTGGTGACC
ATCATCAAGGGGAAGGTGGAGGAGGTGGAGCTCCCAGTGGAGAAGGTGGACATCATCATCAGCGAGTGGA
TGGGCTACTGCCTCTTCTACGAGTCCATGCTCAACACCGTGCTCTATGCCCGGGACAAGTGGCTGGCGCC
CGATGGCCTCATCTTCCCAGACCGGGCCACGCTGTATGTGACGGCCATCGAGGACCGGCAGTACAAAGAC
TACAAGATCCACTGGTGGGAGAACGTGTATGGCTTCGACATGTCTTGCATCAAAGATGTGGCCATTAAGG
AGCCCCTAGTGGATGTCGTGGACCCCAAACAGCTGGTCACCAACGCCTGCCTCATAAAGGAGGTGGACAT
CTATACCGTCAAGGTGGAAGACCTGACCTTCACCTCCCCGTTCTGCCTGCAAGTGAAGCGGAATGACTAC
GTGCACGCCCTGGTGGCCTACTTCAACATCGAGTTCACACGCTGCCACAAGAGGACCGGCTTCTCCACCA
GCCCCGAGTCCCCGTACACGCACTGGAAGCAGACGGTGTTCTACATGGAGGACTACCTGACCGTGAAGAC
GGGCGAGGAGATCTTCGGCACCATCGGCATGCGGCCCAACGCCAAGAACAACCGGGACCTGGACTTCACC
ATCGACCTGGACTTCAAGGGCCAGCTGTGCGAGCTGTCCTGCTCCACCGACTACCGGATGCGC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC224239 representing NM_001536
Red=Cloning site Green=Tags(s)

MAAAEAANCIMENFVATLANGMSLQPPLEEVSCGQAESSEKPNAEDMTSKDYYFDSYAHFGIHEEMLKDE
VRTLTYRNSMFHNRHLFKDKVVLDVGSGTGILCMFAAKAGARKVIGIECSSISDYAVKIVKANKLDHVVT
IIKGKVEEVELPVEKVDIIISEWMGYCLFYESMLNTVLYARDKWLAPDGLIFPDRATLYVTAIEDRQYKD
YKIHWWENVYGFDMSCIKDVAIKEPLVDVVDPKQLVTNACLIKEVDIYTVKVEDLTFTSPFCLQVKRNDY
VHALVAYFNIEFTRCHKRTGFSTSPESPYTHWKQTVFYMEDYLTVKTGEEIFGTIGMRPNAKNNRDLDFT
IDLDFKGQLCELSCSTDYRMR

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_001536
ORF Size 1113 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_001536.3, NM_001536.4, NM_001536.5, NP_001527
RefSeq Size 1386
RefSeq ORF 1116
Locus ID 3276
Cytogenetics 19q13.33
MW 42.3 kDa
Gene Summary This gene encodes a member of the protein arginine N-methyltransferase (PRMT) family. Post-translational modification of target proteins by PRMTs plays an important regulatory role in many biological processes, whereby PRMTs methylate arginine residues by transferring methyl groups from S-adenosyl-L-methionine to terminal guanidino nitrogen atoms. The encoded protein is a type I PRMT and is responsible for the majority of cellular arginine methylation activity. Increased expression of this gene may play a role in many types of cancer. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene, and a pseudogene of this gene is located on the long arm of chromosome 5. [provided by RefSeq, Dec 2011].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (4)