CCBE1 (NM_133459) Human Tagged ORF Clone

CAT#: RC224203

CCBE1 (Myc-DDK-tagged)-Human collagen and calcium binding EGF domains 1 (CCBE1)

Clone Modification / Custom Cloning Service

USD 515.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name CCBE1 (NM_133459) Human Tagged ORF Clone
Symbol CCBE1
Synonyms HKLLS1; HKLLS1
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC224203 representing NM_133459
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGTGCCGCCGCCTCCGAGCCGGGGAGGAGCTGCCAGGGGCCAGCTGGGCAGGAGCCTGGGTCCGCTGC
TGCTGCTCCTGGCGTTGGGACACACGTGGACCTACAGAGAGGAGCCGGAGGACGGCGACAGAGAAATCTG
CTCAGAGAGCAAAATCGCGACGACTAAATACCCGTGTCTGAAGTCTTCAGGCGAGCTCACCACATGCTAC
AGGAAAAAGTGCTGCAAAGGATATAAATTTGTTCTTGGACAATGCATCCCAGAAGATTACGACGTTTGTG
CCGAGGCTCCCTGTGAACAGCAGTGCACGGACAACTTTGGCCGAGTGCTGTGTACTTGTTATCCGGGATA
CCGATATGACCGGGAGAGACACCGGAAGCGGGAGAAGCCATACTGTCTGGATATTGATGAGTGTGCCAGC
AGCAATGGGACGCTGTGTGCCCACATCTGCATCAATACCTTGGGCAGCTACCGCTGCGAGTGCCGGGAAG
GCTACATCCGGGAAGATGATGGGAAGACATGTACCAGGGGAGACAAATATCCCAATGACACTGGCCATGA
GAAGTCTGAGAACATGGTGAAAGCCGGAACTTGCTGTGCCACATGCAAGGAGTTCTACCAGATGAAGCAG
ACCGTGCTGCAGCTGAAGCAAAAGATTGCTCTGCTCCCCAACAATGCAGCTGACCTGGGCAAGTATATCA
CTGGTGACAAGGTGCTGGCCTCAAACACCTACCTTCCAGGACCTCCTGGCCTGCCTGGGGGCCAGGGCCC
TCCCGGCTCACCAGGACCAAAGGGAAGCCCAGGCTTCCCCGGTATGCCAGGCCCTCCTGGGCAGCCCGGC
CCACGGGGCTCAATGGGACCCATGGGACCATCTCCTGATCTGTCCCACATTAAGCAAGGCCGGAGGGGCC
CTGTGGGTCCACCAGGGGCACCAGGAAGAGATGGTTCTAAGGGGGAGAGAGGAGCGCCTGGGCCCAGAGG
GTCTCCAGGACCCCCTGGTTCTTTCGACTTCCTGCTACTTATGCTGGCTGACATCCGCAATGACATCACT
GAGCTGCAGGAAAAGGTGTTCGGGCACCGGACTCACTCTTCAGCAGAGGAGTTCCCTTTACCTCAGGAAT
TTCCCAGCTACCCAGAAGCCATGGACCTGGGCTCTGGAGATGACCATCCAAGAAGAACTGAGACAAGAGA
CTTGAGAGCCCCCAGAGACTTCTACCCA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC224203 representing NM_133459
Red=Cloning site Green=Tags(s)

MVPPPPSRGGAARGQLGRSLGPLLLLLALGHTWTYREEPEDGDREICSESKIATTKYPCLKSSGELTTCY
RKKCCKGYKFVLGQCIPEDYDVCAEAPCEQQCTDNFGRVLCTCYPGYRYDRERHRKREKPYCLDIDECAS
SNGTLCAHICINTLGSYRCECREGYIREDDGKTCTRGDKYPNDTGHEKSENMVKAGTCCATCKEFYQMKQ
TVLQLKQKIALLPNNAADLGKYITGDKVLASNTYLPGPPGLPGGQGPPGSPGPKGSPGFPGMPGPPGQPG
PRGSMGPMGPSPDLSHIKQGRRGPVGPPGAPGRDGSKGERGAPGPRGSPGPPGSFDFLLLMLADIRNDIT
ELQEKVFGHRTHSSAEEFPLPQEFPSYPEAMDLGSGDDHPRRTETRDLRAPRDFYP

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_133459
ORF Size 1218 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_133459.1, NM_133459.2, NM_133459.3, NP_597716
RefSeq Size 3233
RefSeq ORF 1221
Locus ID 147372
Cytogenetics 18q21.32
MW 40.6 kDa
Gene Summary This gene is thought to function in extracellular matrix remodeling and migration. It is predominantly expressed in the ovary, but down regulated in ovarian cancer cell lines and primary carcinomas, suggesting its role as a tumour suppressor. Mutations in this gene have been associated with Hennekam lymphangiectasia-lymphedema syndrome, a generalized lymphatic dysplasia in humans. [provided by RefSeq, Mar 2010].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)