BRIP1(BRIP1) (NM_032043) Human Tagged ORF Clone

CAT#: RC224085

BRIP1 (Myc-DDK-tagged)-Human BRCA1 interacting protein C-terminal helicase 1 (BRIP1)

Clone Modification / Custom Cloning Service

USD 869.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name BRIP1(BRIP1) (NM_032043) Human Tagged ORF Clone
Symbol BRIP1
Synonyms BACH1; FANCJ; OF
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC224085 representing NM_032043
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCTTCAATGTGGTCTGAATATACAATTGGTGGGGTGAAGATTTACTTTCCTTATAAAGCTTACCCGT
CACAGCTTGCTATGATGAATTCTATTCTCAGAGGATTAAACAGCAAGCAACATTGTTTGTTGGAGAGTCC
CACAGGAAGTGGAAAAAGCTTAGCCTTACTTTGTTCTGCTTTAGCATGGCAACAATCTCTTAGTGGGAAA
CCAGCAGATGAGGGCGTAAGTGAAAAAGCTGAAGTACAATTGTCATGTTGTTGTGCATGCCATTCAAAGG
ATTTTACAAACAATGACATGAACCAAGGAACTTCACGTCATTTCAACTATCCAAGCACACCACCTTCTGA
AAGAAATGGCACTTCATCAACTTGTCAAGACTCCCCTGAAAAAACCACTCTGGCTGCAAAGTTATCTGCT
AAGAAACAGGCATCCATATACAGAGATGAAAATGATGATTTTCAAGTAGAGAAGAAAAGAATTCGACCCT
TAGAAACTACACAGCAGATTAGAAAACGTCATTGCTTTGGAACAGAAGTACACAATTTGGATGCAAAAGT
TGATTCAGGAAAGACTGTAAAACTCAACTCTCCACTGGAAAAGATAAACTCCTTTTCGCCACAGAAACCC
CCTGGCCACTGTTCTAGGTGCTGTTGTTCTACTAAACAAGGAAACAGTCAAGAGTCATCGAATACCATTA
AGAAGGATCATACAGGGAAATCCAAGATACCCAAAATATATTTTGGGACACGCACACACAAGCAGATTGC
TCAGATTACTAGAGAGCTCCGGAGGACGGCATATTCAGGGGTTCCAATGACTATTCTTTCCAGCAGGGAT
CATACTTGTGTCCATCCTGAGGTAGTCGGTAACTTCAACAGAAATGAGAAGTGCATGGAATTGCTAGATG
GGAAAAACGGAAAATCCTGCTATTTTTATCATGGAGTTCATAAAATTAGTGATCAGCACACATTACAGAC
TTTCCAAGGGATGTGCAAAGCCTGGGATATAGAAGAACTTGTCAGCCTGGGGAAGAAACTAAAGGCCTGT
CCATATTACACAGCCCGAGAACTAATACAAGATGCTGACATCATATTTTGTCCCTACAACTATCTTCTAG
ATGCACAAATAAGGGAAAGTATGGATTTAAATCTGAAAGAACAGGTTGTCATTTTAGATGAAGCTCATAA
CATCGAGGACTGTGCTCGGGAATCAGCAAGTTACAGTGTAACAGAAGTTCAGCTTCGGTTTGCTCGGGAT
GAACTAGATAGTATGGTCAACAATAATATAAGGAAGAAAGATCATGAACCCCTACGAGCTGTGTGCTGTA
GCCTCATTAATTGGTTAGAAGCAAACGCTGAATATCTTGTAGAAAGAGATTATGAATCAGCTTGTAAAAT
ATGGAGTGGAAATGAAATGCTCTTAACTTTACACAAAATGGGTATCACCACTGCTACTTTTCCCATTTTG
CAGGGACATTTTTCTGCTGTTCTTCAAAAAGAGGAAAAAATCTCACCAATTTATGGTAAAGAGGAGGCAA
GAGAAGTACCTGTTATTAGTGCATCAACTCAAATAATGCTTAAAGGACTTTTTATGGTACTTGACTATCT
TTTTAGGCAAAATAGCAGATTTGCAGATGATTATAAAATTGCGATTCAACAGACTTACTCCTGGACAAAT
CAGATTGATATTTCAGACAAAAATGGGTTGTTGGTTCTACCAAAAAATAAGAAACGTTCACGACAGAAAA
CTGCAGTTCATGTGCTAAACTTTTGGTGCTTAAATCCAGCTGTGGCCTTTTCAGATATTAATGGCAAAGT
TCAGACCATTGTTTTGACATCTGGTACATTATCACCAATGAAATCCTTTTCGTCAGAACTTGGTGTTACA
TTTACTATCCAGCTGGAGGCTAATCATATCATTAAAAATTCACAGGTTTGGGTTGGTACCATTGGGTCAG
GCCCCAAGGGTCGGAATCTCTGTGCTACCTTCCAGAATACTGAAACATTTGAGTTCCAAGATGAAGTGGG
AGCACTTTTGTTATCTGTGTGCCAGACTGTGAGCCAAGGAATTTTGTGTTTCTTGCCATCTTACAAGTTA
TTAGAAAAATTAAAAGAACGTTGGCTCTCTACTGGTTTATGGCATAATCTGGAGTTGGTGAAGACAGTCA
TTGTAGAACCACAGGGAGGAGAAAAAACAAATTTTGATGAATTACTGCAGGTGTACTATGACGCAATCAA
ATACAAAGGAGAGAAAGATGGAGCTCTCCTGGTAGCAGTTTGTCGTGGTAAAGTGAGTGAGGGTCTGGAT
TTCTCAGATGACAATGCCCGTGCTGTCATAACAATAGGAATTCCTTTTCCAAATGTGAAAGATCTACAGG
TTGAACTAAAACGACAATACAATGACCACCATTCAAAATTGAGAGGTCTTCTACCTGGCCGTCAGTGGTA
TGAAATTCAAGCATACAGGGCCTTAAACCAGGCCCTTGGTAGATGTATTAGACACAGAAATGATTGGGGA
GCTCTTATTCTAGTGGATGATCGCTTTAGGAATAACCCAAGTCGCTATATATCTGGACTTTCTAAATGGG
TACGGCAGCAGATTCAGCACCATTCAACCTTTGAAAGTGCACTGGAGTCCTTGGCTGAATTTTCCAAAAA
GCATCAAAAAGTTCTTAATGTATCCATAAAGGACAGAACCAATATACAGGACAATGAGTCTACACTTGAA
GTGACCTCTTTAAAGTACAGTACCCCACCTTATTTACTGGAAGCAGCAAGTCATCTATCACCAGAAAATT
TTGTGGAAGATGAAGCAAAGATATGTGTCCAGGAACTACAGTGTCCTAAAATTATTACCAAAAATTCACC
TCTACCAAGTAGCATTATCTCCAGAAAGGAGAAAAATGATCCAGTATTCCTGGAAGAAGCAGGGAAAGCA
GAAAAAATTGTGATTTCCAGATCCACAAGCCCAACTTTCAACAAACAAACAAAGAGAGTTAGCTGGTCAA
GCTTTAATTCTTTGGGACAGTATTTTACTGGTAAAATACCGAAGGCAACACCTGAGCTCGGGTCATCAGA
GAATAGTGCCTCTAGTCCTCCCCGTTTCAAAACAGAGAAGATGGAAAGTAAAACTGTTTTGCCCTTCACT
GATAAATGTGAATCCTCAAATCTGACAGTAAACACATCGTTTGGATCATGCCCTCAATCAGAAACCATTA
TTTCATCATTAAAGATTGATGCCACCCTTACTAGAAAAAATCATTCTGAACATCCGCTCTGTTCTGAAGA
AGCCCTGGATCCAGACATTGAATTGTCTCTAGTAAGTGAAGAAGATAAACAGTCCACTTCAAATAGAGAT
TTTGAAACAGAAGCAGAAGATGAATCTATCTATTTTACACCTGAACTTTACGATCCTGAAGATACAGATG
AAGAAAAAAATGACCTAGCTGAAACTGATAGAGGAAATAGATTGGCTAACAATTCAGATTGCATTTTAGC
TAAAGACCTTTTTGAAATTAGAACTATAAAAGAAGTAGATTCAGCCAGAGAAGTGAAAGCTGAGGATTGC
ATAGATACAAAGTTGAATGGAATTCTGCATATTGAAGAAAGTAAAATTGATGACATTGATGGTAATGTAA
AAACAACTTGGATAAATGAACTGGAACTGGGAAAAACTCATGAAATAGAAATAAAGAACTTTAAACCATC
TCCTTCCAAAAATAAAGGCATGTTTCCTGGTTTTAAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC224085 representing NM_032043
Red=Cloning site Green=Tags(s)

MSSMWSEYTIGGVKIYFPYKAYPSQLAMMNSILRGLNSKQHCLLESPTGSGKSLALLCSALAWQQSLSGK
PADEGVSEKAEVQLSCCCACHSKDFTNNDMNQGTSRHFNYPSTPPSERNGTSSTCQDSPEKTTLAAKLSA
KKQASIYRDENDDFQVEKKRIRPLETTQQIRKRHCFGTEVHNLDAKVDSGKTVKLNSPLEKINSFSPQKP
PGHCSRCCCSTKQGNSQESSNTIKKDHTGKSKIPKIYFGTRTHKQIAQITRELRRTAYSGVPMTILSSRD
HTCVHPEVVGNFNRNEKCMELLDGKNGKSCYFYHGVHKISDQHTLQTFQGMCKAWDIEELVSLGKKLKAC
PYYTARELIQDADIIFCPYNYLLDAQIRESMDLNLKEQVVILDEAHNIEDCARESASYSVTEVQLRFARD
ELDSMVNNNIRKKDHEPLRAVCCSLINWLEANAEYLVERDYESACKIWSGNEMLLTLHKMGITTATFPIL
QGHFSAVLQKEEKISPIYGKEEAREVPVISASTQIMLKGLFMVLDYLFRQNSRFADDYKIAIQQTYSWTN
QIDISDKNGLLVLPKNKKRSRQKTAVHVLNFWCLNPAVAFSDINGKVQTIVLTSGTLSPMKSFSSELGVT
FTIQLEANHIIKNSQVWVGTIGSGPKGRNLCATFQNTETFEFQDEVGALLLSVCQTVSQGILCFLPSYKL
LEKLKERWLSTGLWHNLELVKTVIVEPQGGEKTNFDELLQVYYDAIKYKGEKDGALLVAVCRGKVSEGLD
FSDDNARAVITIGIPFPNVKDLQVELKRQYNDHHSKLRGLLPGRQWYEIQAYRALNQALGRCIRHRNDWG
ALILVDDRFRNNPSRYISGLSKWVRQQIQHHSTFESALESLAEFSKKHQKVLNVSIKDRTNIQDNESTLE
VTSLKYSTPPYLLEAASHLSPENFVEDEAKICVQELQCPKIITKNSPLPSSIISRKEKNDPVFLEEAGKA
EKIVISRSTSPTFNKQTKRVSWSSFNSLGQYFTGKIPKATPELGSSENSASSPPRFKTEKMESKTVLPFT
DKCESSNLTVNTSFGSCPQSETIISSLKIDATLTRKNHSEHPLCSEEALDPDIELSLVSEEDKQSTSNRD
FETEAEDESIYFTPELYDPEDTDEEKNDLAETDRGNRLANNSDCILAKDLFEIRTIKEVDSAREVKAEDC
IDTKLNGILHIEESKIDDIDGNVKTTWINELELGKTHEIEIKNFKPSPSKNKGMFPGFK

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_032043
ORF Size 3747 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_032043.1, NM_032043.2, NP_114432
RefSeq Size 4563
RefSeq ORF 3750
Locus ID 83990
Cytogenetics 17q23.2
Protein Families Druggable Genome
MW 140.7 kDa
Gene Summary The protein encoded by this gene is a member of the RecQ DEAH helicase family and interacts with the BRCT repeats of breast cancer, type 1 (BRCA1). The bound complex is important in the normal double-strand break repair function of breast cancer, type 1 (BRCA1). This gene may be a target of germline cancer-inducing mutations. [provided by RefSeq, Jul 2008]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations