Dystrobrevin alpha (DTNA) (NM_032979) Human Tagged ORF Clone

CAT#: RC223952

Reviews ()
Write a review

DTNA (Myc-DDK-tagged)-Human dystrobrevin, alpha (DTNA), transcript variant 5



  "NM_032979" in other vectors (4)

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 544.00


Availability*
In Stock

Size
    • 10 ug


Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol DTNA
Synonyms D18S892E; DRP3; DTN; DTN-A; LVNC1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC223952 representing NM_032979
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGATTGAAGATAGTGGGAAAAGAGGAAATACCATGGCAGAAAGAAGACAGCTGTTTGCAGAGATGAGGG
CTCAAGATCTGGATCGCATCCGACTCTCCACCTACAGAACAGCATGCAAGCTTAGGTTTGTTCAGAAGAA
ATGCAATTTGCACCTGGTGGACATATGGAATGTCATAGAAGCATTGCGGGAAAATGCTCTGAACAACCTG
GACCCAAACACTGAACTCAACGTGTCCCGCTTAGAGGCTGTGCTCTCCACTATTTTTTACCAGCTCAACA
AACGGATGCCAACCACTCACCAAATCCATGTGGAGCAGTCCATCAGCCTCCTCCTTAACTTCCTGCTTGC
AGCGTTTGATCCGGAAGGCCATGGTAAAATTTCAGTATTTGCTGTCAAAATGGCTTTAGCCACATTGTGT
GGAGGGAAGATCATGGACAAATTAAGATATATTTTCTCAATGATTTCTGACTCCAGTGGGGTGATGGTTT
ATGGACGATATGACCAATTCCTTCGGGAAGTTCTCAAACTACCCACGGCAGTTTTTGAAGGTCCTTCATT
TGGTTACACAGAACAGTCAGCCAGATCCTGTTTCTCCCAACAGAAAAAAGTCACGTTAAATGGTTTCTTG
GACACGCTTATGTCAGATCCTCCCCCGCAGTGTCTGGTCTGGTTGCCTCTTCTGCATCGACTAGCAAATG
TGGAAAATGTCTTCCATCCGGTTGAGTGTTCCTACTGCCACAGTGAGAGTATGATGGGATTTCGCTACCG
ATGCCAACAGTGTCACAATTACCAGCTCTGTCAGGACTGCTTCTGGAGGGGACATGCCGGTGGTTCTCAT
AGCAACCAGCACCAAATGAAAGAGTACACGTCATGGAAATCACCTGCTAAGAAGCTGACTAATGCATTAA
GCAAGTCCCTGAGCTGTGCTTCCAGCCGTGAACCTTTGCACCCCATGTTCCCAGATCAGCCTGAGAAGCC
ACTCAACTTGGCTCACATCGTTGATACTTGGCCTCCCAGACCTGTAACCAGCATGAACGACACCCTGTTC
TCCCACTCTGTTCCCTCCTCAGGAAGTCCTTTTATTACCAGGAGCATGCTTGAGAGTTCAAACCGGCTTG
ATGAAGAACACAGGCTAATTGCCAGGTATGCGGCAAGGCTGGCAGCAGAGTCCTCTTCGTCTCAGCCACC
TCAGCAGAGAAGTGCTCCTGACATCTCTTTCACCATCGATGCGAATAAGCAGCAAAGGCAGCTGATTGCT
GAGCTAGAAAACAAGAACAGAGAAATCTTACAGGAGATCCAGAGACTTCGGCTAGAGCATGAACAAGCTT
CTCAGCCCACGCCAGAGAAGGCACAGCAAAACCCCACCCTGCTGGCAGAACTCCGGCTCCTCAGACAGCG
CAAAGATGAGCTGGAACAGAGAATGTCTGCTCTCCAGGAGAGCCGGAGAGAGCTAATGGTCCAGTTGGAG
GGTCTCATGAAGCTACTAAAGGAAGAAGAACTGAAGCAGGGAGTAAGTTATGTCCCCTACTGCAGGTCT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC223952 representing NM_032979
Red=Cloning site Green=Tags(s)

MIEDSGKRGNTMAERRQLFAEMRAQDLDRIRLSTYRTACKLRFVQKKCNLHLVDIWNVIEALRENALNNL
DPNTELNVSRLEAVLSTIFYQLNKRMPTTHQIHVEQSISLLLNFLLAAFDPEGHGKISVFAVKMALATLC
GGKIMDKLRYIFSMISDSSGVMVYGRYDQFLREVLKLPTAVFEGPSFGYTEQSARSCFSQQKKVTLNGFL
DTLMSDPPPQCLVWLPLLHRLANVENVFHPVECSYCHSESMMGFRYRCQQCHNYQLCQDCFWRGHAGGSH
SNQHQMKEYTSWKSPAKKLTNALSKSLSCASSREPLHPMFPDQPEKPLNLAHIVDTWPPRPVTSMNDTLF
SHSVPSSGSPFITRSMLESSNRLDEEHRLIARYAARLAAESSSSQPPQQRSAPDISFTIDANKQQRQLIA
ELENKNREILQEIQRLRLEHEQASQPTPEKAQQNPTLLAELRLLRQRKDELEQRMSALQESRRELMVQLE
GLMKLLKEEELKQGVSYVPYCRS

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_032979
ORF Size 1539 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_032979.5
RefSeq Size 3110 bp
RefSeq ORF 1542 bp
Locus ID 1837
UniProt ID Q9Y4J8
Cytogenetics 18q12.1
Domains ZnF_ZZ
Protein Families Druggable Genome
MW 58.7 kDa
Gene Summary The protein encoded by this gene belongs to the dystrobrevin subfamily of the dystrophin family. This protein is a component of the dystrophin-associated protein complex (DPC), which consists of dystrophin and several integral and peripheral membrane proteins, including dystroglycans, sarcoglycans, syntrophins and alpha- and beta-dystrobrevin. The DPC localizes to the sarcolemma and its disruption is associated with various forms of muscular dystrophy. Mutations in this gene are associated with left ventricular noncompaction with congenital heart defects. Multiple alternatively spliced transcript variants encoding different isoforms have been identified for this gene. [provided by RefSeq, Jul 2008]

Other Versions

Other products for "DTNA"
Frequently bought together (4)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 165.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 627.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 149.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 55.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.