VE Cadherin(CDH5) (NM_001795) Human Tagged ORF Clone

CAT#: RC223907

CDH5 (Myc-DDK-tagged)-Human cadherin 5, type 2 (vascular endothelium) (CDH5)

Clone Modification / Custom Cloning Service

  • TrueORF®

USD 1,195.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name VE Cadherin(CDH5) (NM_001795) Human Tagged ORF Clone
Symbol CDH5
Synonyms 7B4; CD144
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC223907 representing NM_001795
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCAGAGGCTCATGATGCTCCTCGCCACATCGGGCGCCTGCCTGGGCCTGCTGGCAGTGGCAGCAGTGG
CAGCAGCAGGTGCTAACCCTGCCCAACGGGACACCCACAGCCTGCTGCCCACCCACCGGCGCCAAAAGAG
AGATTGGATTTGGAACCAGATGCACATTGATGAAGAGAAAAACACCTCACTTCCCCATCATGTAGGCAAG
ATCAAGTCAAGCGTGAGTCGCAAGAATGCCAAGTACCTGCTCAAAGGAGAATATGTGGGCAAGGTCTTCC
GGGTCGATGCAGAGACAGGAGACGTGTTCGCCATTGAGAGGCTGGACCGGGAGAATATCTCAGAGTACCA
CCTCACTGCTGTCATTGTGGACAAGGACACTGGCGAAAACCTGGAGACTCCTTCCAGCTTCACCATCAAA
GTTCATGACGTGAACGACAACTGGCCTGTGTTCACGCATCGGTTGTTCAATGCGTCCGTGCCTGAGTCGT
CGGCTGTGGGGACCTCAGTCATCTCTGTGACAGCAGTGGATGCAGACGACCCCACTGTGGGAGACCACGC
CTCTGTCATGTACCAAATCCTGAAGGGGAAAGAGTATTTTGCCATCGATAATTCTGGACGTATTATCACA
ATAACGAAAAGCTTGGACCGAGAGAAGCAGGCCAGGTATGAGATCGTGGTGGAAGCGCGAGATGCCCAGG
GCCTCCGGGGGGACTCGGGCACGGCCACCGTGCTGGTCACTCTGCAAGACATCAATGACAACTTCCCCTT
CTTCACCCAGACCAAGTACACATTTGTCGTGCCTGAAGACACCCGTGTGGGCACCTCTGTGGGCTCTCTG
TTTGTTGAGGACCCAGATGAGCCCCAGAACCGGATGACCAAGTACAGCATCTTGCGGGGCGACTACCAGG
ACGCTTTCACCATTGAGACAAACCCCGCCCACAACGAGGGCATCATCAAGCCCATGAAGCCTCTGGATTA
TGAATACATCCAGCAATACAGCTTCATCGTCGAGGCCACAGACCCCACCATCGACCTCCGATACATGAGC
CCTCCCGCGGGAAACAGAGCCCAGGTCATTATCAACATCACAGATGTGGACGAGCCCCCCATTTTCCAGC
AGCCTTTCTACCACTTCCAGCTGAAGGAAAACCAGAAGAAGCCTCTGATTGGCACAGTGCTGGCCATGGA
CCCTGATGCGGCTAGGCATAGCATTGGATACTCCATCCGCAGGACCAGTGACAAGGGCCAGTTCTTCCGA
GTCACAAAAAAGGGGGACATTTACAATGAGAAAGAACTGGACAGAGAAGTCTACCCCTGGTATAACCTGA
CTGTGGAGGCCAAAGAACTGGATTCCACTGGAACCCCCACAGGAAAAGAATCCATTGTGCAAGTCCACAT
TGAAGTTTTGGATGAGAATGACAATGCCCCGGAGTTTGCCAAGCCCTACCAGCCCAAAGTGTGTGAGAAC
GCTGTCCATGGCCAGCTGGTCCTGCAGATCTCCGCAATAGACAAGGACATAACACCACGAAACGTGAAGT
TCAAATTCATCTTGAATACTGAGAACAACTTTACCCTCACGGATAATCACGATAACACGGCCAACATCAC
AGTCAAGTATGGGCAGTTTGACCGGGAGCATACCAAGGTCCACTTCCTACCCGTGGTCATCTCAGACAAT
GGGATGCCAAGTCGCACGGGCACCAGCACGCTGACCGTGGCCGTGTGCAAGTGCAACGAGCAGGGCGAGT
TCACCTTCTGCGAGGATATGGCCGCCCAGGTGGGCGTGAGCATCCAGGCAGTGGTAGCCATCTTACTCTG
CATCCTCACCATCACAGTGATCACCCTGCTCATCTTCCTGCGGCGGCGGCTCCGGAAGCAGGCCCGCGCG
CACGGCAAGAGCGTGCCGGAGATCCACGAGCAGCTGGTCACCTACGACGAGGAGGGCGGCGGCGAGATGG
ACACCACCAGCTACGATGTGTCGGTGCTCAACTCGGTGCGCCGCGGCGGGGCCAAGCCCCCGCGGCCCGC
GCTGGACGCCCGGCCTTCCCTCTATGCGCAGGTGCAGAAGCCACCGAGGCACGCGCCTGGGGCACACGGA
GGGCCCGGGGAGATGGCAGCCATGATCGAGGTGAAGAAGGACGAGGCGGACCACGACGGCGACGGCCCCC
CCTACGACACGCTGCACATCTACGGCTACGAGGGCTCCGAGTCCATAGCCGAGTCCCTCAGCTCCCTGGG
CACCGACTCATCCGACTCTGACGTGGATTACGACTTCCTTAACGACTGGGGACCCAGGTTTAAGATGCTG
GCTGAGCTGTACGGCTCGGACCCCCGGGAGGAGCTGCTGTAT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC223907 representing NM_001795
Red=Cloning site Green=Tags(s)

MQRLMMLLATSGACLGLLAVAAVAAAGANPAQRDTHSLLPTHRRQKRDWIWNQMHIDEEKNTSLPHHVGK
IKSSVSRKNAKYLLKGEYVGKVFRVDAETGDVFAIERLDRENISEYHLTAVIVDKDTGENLETPSSFTIK
VHDVNDNWPVFTHRLFNASVPESSAVGTSVISVTAVDADDPTVGDHASVMYQILKGKEYFAIDNSGRIIT
ITKSLDREKQARYEIVVEARDAQGLRGDSGTATVLVTLQDINDNFPFFTQTKYTFVVPEDTRVGTSVGSL
FVEDPDEPQNRMTKYSILRGDYQDAFTIETNPAHNEGIIKPMKPLDYEYIQQYSFIVEATDPTIDLRYMS
PPAGNRAQVIINITDVDEPPIFQQPFYHFQLKENQKKPLIGTVLAMDPDAARHSIGYSIRRTSDKGQFFR
VTKKGDIYNEKELDREVYPWYNLTVEAKELDSTGTPTGKESIVQVHIEVLDENDNAPEFAKPYQPKVCEN
AVHGQLVLQISAIDKDITPRNVKFKFILNTENNFTLTDNHDNTANITVKYGQFDREHTKVHFLPVVISDN
GMPSRTGTSTLTVAVCKCNEQGEFTFCEDMAAQVGVSIQAVVAILLCILTITVITLLIFLRRRLRKQARA
HGKSVPEIHEQLVTYDEEGGGEMDTTSYDVSVLNSVRRGGAKPPRPALDARPSLYAQVQKPPRHAPGAHG
GPGEMAAMIEVKKDEADHDGDGPPYDTLHIYGYEGSESIAESLSSLGTDSSDSDVDYDFLNDWGPRFKML
AELYGSDPREELLY

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_001795
ORF Size 2352 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_001795.1, NM_001795.2, NM_001795.3, NM_001795.4, NP_001786
RefSeq Size 4134
RefSeq ORF 2355
Locus ID 1003
Cytogenetics 16q21
Domains Cadherin_C_term, CA
Protein Families ES Cell Differentiation/IPS, Transmembrane, Druggable Genome
Protein Pathways Cell adhesion molecules (CAMs), Leukocyte transendothelial migration
MW 87.5 kDa
Gene Summary This gene encodes a classical cadherin of the cadherin superfamily. The encoded preproprotein is proteolytically processed to generate the mature glycoprotein. This calcium-dependent cell-cell adhesion molecule is comprised of five extracellular cadherin repeats, a transmembrane region and a highly conserved cytoplasmic tail. Functioning as a classical cadherin by imparting to cells the ability to adhere in a homophilic manner, this protein plays a role in endothelial adherens junction assembly and maintenance. This gene is located in a gene cluster in a region on the long arm of chromosome 16 that is involved in loss of heterozygosity events in breast and prostate cancer. [provided by RefSeq, Nov 2015]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations