GPR34 (NM_001097579) Human Tagged ORF Clone

CAT#: RC223795

GPR34 (Myc-DDK-tagged)-Human G protein-coupled receptor 34 (GPR34), transcript variant 4

Clone Modification / Custom Cloning Service

  • TrueORF®

USD 485.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name GPR34 (NM_001097579) Human Tagged ORF Clone
Symbol GPR34
Synonyms LYPSR1; LYPSR1
Vector pCMV6-Entry
Sequence Data
>RC223795 representing NM_001097579
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAGAAGTCATACCATAACAATGACGACAACTTCAGTCAGCAGCTGGCCTTACTCCTCCCACAGAATGC
GCTTTATAACCAATCATAGCGACCAACCGCCACAAAACTTCTCAGCAACACCAAATGTTACTACCTGTCC
CATGGATGAAAAATTGCTATCTACTGTGTTAACCACATCCTACTCTGTTATTTTCATCGTGGGACTGGTT
GGGAACATAATCGCCCTCTATGTATTTCTGGGTATTCACCGTAAAAGAAATTCCATTCAAATTTATCTAC
TTAACGTAGCCATTGCAGACCTCCTACTCATCTTCTGCCTCCCTTTCCGAATAATGTATCATATTAACCA
AAACAAGTGGACACTAGGTGTGATTCTGTGCAAGGTTGTGGGAACACTGTTTTATATGAACATGTACATT
AGCATTATTTTGCTTGGATTCATCAGTTTGGATCGCTATATAAAAATTAATCGGTCTATACAGCAACGGA
AGGCAATAACAACCAAACAAAGTATTTATGTCTGTTGTATAGTATGGATGCTTGCTCTTGGTGGATTCCT
AACTATGATTATTTTAACACTTAAGAAAGGAGGGCATAATTCCACAATGTGTTTCCATTACAGAGATAAG
CATAACGCAAAAGGAGAAGCCATTTTTAACTTCATTCTTGTGGTAATGTTCTGGCTAATTTTCTTACTAA
TAATCCTTTCATATATTAAGATTGGGAAGAATCTATTGAGGATTTCTAAAAGGAGGTCAAAATTTCCTAA
TTCTGGTAAATATGCCACTACAGCTCGTAACTCCTTTATTGTACTTATCATTTTTACTATATGTTTTGTT
CCCTATCATGCCTTTCGATTCATCTACATTTCTTCACAGCTAAATGTATCATCTTGCTACTGGAAAGAAA
TTGTTCACAAAACCAATGAGATCATGCTGGTTCTCTCATCTTTCAATAGTTGCTTAGATCCAGTCATGTA
TTTCCTGATGTCCAGTAACATTCGCAAAATAATGTGCCAACTTCTTTTTAGACGATTTCAAGGTGAACCA
AGTAGGAGTGAAAGCACTTCAGAATTTAAACCAGGATACTCCCTGCATGATACATCTGTGGCAGTGAAAA
TACAGTCTAGTTCTAAAAGTACT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC223795 representing NM_001097579
Red=Cloning site Green=Tags(s)

MRSHTITMTTTSVSSWPYSSHRMRFITNHSDQPPQNFSATPNVTTCPMDEKLLSTVLTTSYSVIFIVGLV
GNIIALYVFLGIHRKRNSIQIYLLNVAIADLLLIFCLPFRIMYHINQNKWTLGVILCKVVGTLFYMNMYI
SIILLGFISLDRYIKINRSIQQRKAITTKQSIYVCCIVWMLALGGFLTMIILTLKKGGHNSTMCFHYRDK
HNAKGEAIFNFILVVMFWLIFLLIILSYIKIGKNLLRISKRRSKFPNSGKYATTARNSFIVLIIFTICFV
PYHAFRFIYISSQLNVSSCYWKEIVHKTNEIMLVLSSFNSCLDPVMYFLMSSNIRKIMCQLLFRRFQGEP
SRSESTSEFKPGYSLHDTSVAVKIQSSSKST

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_001097579
ORF Size 1143 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_001097579.1, NP_001091048
RefSeq Size 1938
RefSeq ORF 1146
Locus ID 2857
Cytogenetics Xp11.4
Protein Families GPCR, Transmembrane, Druggable Genome
MW 43.7 kDa
Gene Summary G protein-coupled receptors (GPCRs), such as GPR34, are integral membrane proteins containing 7 putative transmembrane domains (TMs). These proteins mediate signals to the interior of the cell via activation of heterotrimeric G proteins that in turn activate various effector proteins, ultimately resulting in a physiologic response.[supplied by OMIM, Apr 2006].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)